(data stored in ACNUC7421 zone)

EMBL: CP000947.PE204

CP000947.PE204       Location/Qualifiers
FT   CDS_pept        217835..218533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0208"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_0337 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31830"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW13"
FT                   /protein_id="ACA31830.1"
FT                   /translation="MRGGGGNFNFYGKAGIDLTSRFETMKITENHDSDRGFKLSIPASS
FT                   RQNTFSPSIFFETTYNILPQTEIGLGLGYIKRKGFDHIAIWPVEGSSLYNPQGQFHLKE
FT                   TYRVNRYASLPIYFILKQNYALNANTKFYLKGDLGYSINKIRKTVYTLYEDLSLGSSTG
FT                   YKKDRDFISNNKSRSGLYLGLGLGIEYKSFLVDIGYYHTHSKITYKEQGSYVSTPYNND
FT                   AIRLTLGFKF"
     atgcgggggg gggggggtaa tttcaacttt tacggcaaag cgggaattga tttaacctct        60
     cgatttgaaa cgatgaaaat aacggaaaat cacgatagtg atagaggttt taaattatca       120
     attccggcaa gttcaagaca aaacactttc tcacccagta tcttctttga aacgacttac       180
     aatattttac cgcaaacgga aattggtctc ggactaggct atatcaaacg aaaaggcttt       240
     gaccatattg caatttggcc tgtcgagggt agttctttat ataaccccca aggacagttt       300
     catctgaaag aaacctatag agtaaatcgt tatgcttccc tgccaattta ttttattttg       360
     aaacaaaatt atgccttaaa tgcaaataca aaattttatc taaagggcga tttagggtat       420
     tcaattaata aaattcgtaa aacagtatat actctctatg aggatttatc cttgggtagt       480
     agcacaggtt acaaaaaaga cagagatttt attagtaata ataaatctag aagcggtctt       540
     tacttaggtt taggtttggg gattgaatat aaatctttct tagtagatat tggatattat       600
     catactcatt caaaaatcac ttacaaagag caaggaagtt acgtatcaac accctataac       660
     aacgatgcaa tacgcttaac gcttggcttt aaattctaa                              699
//

If you have problems or comments...

PBIL Back to PBIL home page