(data stored in ACNUC7421 zone)

EMBL: CP000947.PE206

CP000947.PE206       Location/Qualifiers
FT   CDS_pept        220629..222389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0210"
FT                   /product="surface antigen (D15)"
FT                   /note="PFAM: surface antigen (D15); surface antigen
FT                   variable number repeat protein; KEGG: hso:HS_0339 conserved
FT                   outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31833"
FT                   /db_xref="GOA:B0UW15"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR035243"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW15"
FT                   /protein_id="ACA31833.1"
FT                   /translation="MKLLSKYFVRSILNTSIFCIYLASSFSFAEHLVDLKVVGVTGVQK
FT                   TTNVDAYINTIDEEERDGSERYQQLVRTAIDKALRAYGYYSSTVNFTLQPAKSSNKPVL
FT                   VANVDMGRPSIIQRADVTILGEAKDDEVFQDLLRRTAQKGEHVSHPVYEDYKSRLQKQL
FT                   LARGYFDAKFEVSRFEIKPSTYQGWWKMVLNSGTRYKFGQFNFKHSQIREDYLRNMMPI
FT                   KTGDKYLINDLSSLTNDYTSSNWFRSVLLEPKVDEKRKVVDINVLLYPRKKNAIDVGIG
FT                   YSSDVGTRFKLSWIKPWINNRGHSFNSNLYISAPKQTLEANYKIPLLKNPQRYYYELSG
FT                   GFEKENTKDTQTIAASFAALRYWNRVTGWQHSFGLRVRYDSFTQANVSDRTLFIYPTIS
FT                   ANRTRLRGELFPTWGDSQRITVDFGSKRWKSDVNFFRIKASTVWIRTFKENHRFLTRGE
FT                   IGWLHTKDINKIPPALRFFAGGERSVRGYGYKKISPTSSDGKPIGAPYLLTVNTEYQYQ
FT                   VLEDWWLAAFADTGLAANKFNVKELRYGAGFGVRWVSPVGAIKLDIATPIRDREKNKNI
FT                   QFYIGLGSEL"
     atgaaattac taagtaaata ttttgtcaga tcaatactga acacgagcat attttgcata        60
     tacctagcaa gttcgttttc ttttgctgaa catcttgttg atttaaaagt tgttggtgta       120
     actggtgtac aaaaaacgac taatgtagac gcttatataa ataccattga tgaagaagag       180
     cgtgatggat ctgaacgtta tcaacaatta gttcgaaccg caattgataa agcattacgt       240
     gcttatggtt attacagtag cacagtgaat ttcactttac agccggcgaa atcatctaat       300
     aaacccgtgc ttgttgcaaa tgtggacatg ggaaggccaa gtattattca acgtgccgat       360
     gttactattc ttggtgaagc aaaagatgat gaggtttttc aagatttact tcgtcgtact       420
     gcccaaaaag gcgaacacgt aagccatcct gtttatgagg actataaaag ccggttgcaa       480
     aagcaattac tcgctcgtgg gtattttgat gcaaagtttg aggtttctcg ttttgaaatc       540
     aaaccatcca cttatcaagg ttggtggaaa atggttttaa acagtggcac cagatacaaa       600
     ttcggacaat tcaattttaa gcatagtcaa attcgtgaag attacttacg caatatgatg       660
     ccaatcaaaa caggcgataa atatttaatt aatgatctct catcacttac taacgactat       720
     acatcatcaa attggtttag atcggtttta ttagaaccga aagtcgatga aaaacgcaag       780
     gtggttgata ttaatgtatt gctttatcct cgcaagaaaa atgcaataga tgtagggatt       840
     gggtattcgt ctgatgtagg cactcgattc aagctcagtt ggattaagcc ttggattaat       900
     aatcgtggac atagtttcaa ttccaattta tatatatcag ccccaaaaca aactcttgag       960
     gcgaattata aaattccctt actgaaaaat ccgcaaagat attattatga actgtctggc      1020
     ggttttgaaa aggaaaatac taaagatact caaactatag cagcaagttt tgctgcatta      1080
     cgctactgga atagagtgac cggttggcaa cattcttttg ggttacgtgt acgttatgac      1140
     tcatttaccc aagccaatgt ttcagataga acattattta tttatccaac aatatcggcg      1200
     aatagaacac gcttaagagg tgagttattt cctacttggg gagactcaca acgcatcacg      1260
     gtagattttg gaagtaaacg ttggaagtct gatgtaaact tctttcgaat aaaggcctca      1320
     acagtttgga tcagaacgtt taaagaaaat catcgtttct tgacacgtgg cgaaataggt      1380
     tggttacaca ccaaagatat taataaaata ccgcccgcac ttcgcttttt tgcaggcggg      1440
     gagcgtagtg tgcgtggata cggttacaag aaaatttctc caacatcttc tgatggcaaa      1500
     ccaataggtg caccatatct attaactgtt aatactgagt accaatatca agtacttgaa      1560
     gattggtggc tggcagcctt tgctgatacg gggttggctg ctaataaatt taacgttaaa      1620
     gaactacgtt atggtgccgg ttttggtgtg cgttgggtat caccggtggg agcaataaaa      1680
     cttgatatag ctacaccgat tcgagataga gagaagaata aaaatatcca attttatatt      1740
     ggattaggtt cagaattata a                                                1761
//

If you have problems or comments...

PBIL Back to PBIL home page