(data stored in ACNUC7421 zone)

EMBL: CP000947.PE207

CP000947.PE207       Location/Qualifiers
FT   CDS_pept        222400..225927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0211"
FT                   /product="protein of unknown function DUF490"
FT                   /note="PFAM: protein of unknown function DUF490; KEGG:
FT                   hso:HS_0340 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31834"
FT                   /db_xref="GOA:B0UW16"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW16"
FT                   /protein_id="ACA31834.1"
FT                   /translation="MTQIPNENTTTERQETRSVKPKRKVLRWILCTISAVILLLILFLV
FT                   TALATNSGQRLLIQLADHFIDNLHIAQIDGGLQDGLQLKQIAFHTQGIKADIEQANIKL
FT                   DLHCLLSGKICLKDLTLNQPKIQIDTAQLPKSETKTSQPIQQIKLPVEVDINGIEINQL
FT                   DLTIDQQQVKLAKFRTALTLNNEQGLTLLPTEINGLTIVHRHLTEKTTKKKKSEKTVRS
FT                   PVDWEKLTQQLNQPLLPDMPEIELPFDLHIQGIQGKNWLYQQIGNSNIPQSDLHQIEIS
FT                   TIYLHADSIDNSIQLQTFQLESNLGQLRGEGTLRLKQEFPIELQVQATLNELKHDGKLL
FT                   LPHSNINFTLSGNLKKQTALFLQTQGTLESILQGKIELYSQKTPFDIELKVINGQYPFE
FT                   KNSTDPLKIQDMFFTAKGDLLNYQATLQGKLIGMGMPETNVDLVLQGGLTQFTLQQLRV
FT                   NALNMKANANANVSWKDKLKLKSNIDLKGHNVRLNNMRINKIDLLANISLQDIVQGQVD
FT                   LDIDGFSLNNIKLNSTKLQIKGTEQQHYLILKSKGEPASATLNLQGKFDRTLQQWQGIL
FT                   SQVNIHSLIGNLTNSENILLSYDNKKTIAQVSAHCWRSSDIHLCFQQEFIVGKTGEIPF
FT                   DFKTINLALVNKLISQEIFKGHLSGQGKFAWFTESSPYLTLQLKGDNLNVAKKLDYRTF
FT                   RLAIPTLNITTELQNNNLTLNSNFNIQNRGDVNMELKLADLTNQKRLSGHLKISDMNLN
FT                   IVNQLIASSEKVDGQVNAKLSFAGDLSNPLLNGEFAVSQVRAKLKSVPFGITNGNIILS
FT                   FYGDRSILKGNIQTHESHLNIEGQANWRKLDDWQAGLHINADKFKVDIPSIAKLQVSPN
FT                   IEIHATPKLLALSGNVDIPWARIEIERLPDNIVAPSKDEVILDGPQKTKVVKLMKGEIE
FT                   TTTKSGIQIHSDLKIKLGDHVRLEAYGLKTELNGLLSVKQEKGNLGLFGQINLHNGHYE
FT                   SFGQDLLIRKGIISFSGLPSQPMLNIEAIRNPTSMENTNMTVGAKIVGIADSPEITIFS
FT                   EPSTSQDQALSYLLTGRSLENSGNNGSGGSLGAALLGIGLAKSGKLVGGIGKVFGIQNL
FT                   NLDTSGVGDSSKVVVSGNITPTLQIKYGIGLFDGLAELTLRYRLLPKLYLQSVSGINQA
FT                   VDLLYQFEF"
     atgacacaaa taccaaatga aaatacaaca acagagcgac aggaaactcg ctcggttaag        60
     ccaaaacgta aggtattacg ctggatttta tgcacaataa gtgcggtcat tttattactt       120
     attttatttt tagtaaccgc actggctaca aatagcggac aacgcttgct cattcagctt       180
     gctgatcatt tcatagataa tctgcatatt gctcaaattg atggtgggtt gcaagacggt       240
     ttacaattaa aacaaattgc ttttcacact caaggtatta aagctgatat tgaacaagca       300
     aatataaaac tggacttaca ttgtctatta agtggcaaga tttgcttaaa agatctcact       360
     ttaaatcagc ctaaaattca gattgatact gctcaactgc caaagtcgga aactaaaacg       420
     tcacaaccaa tacaacaaat caagctacct gttgaagtgg acatcaatgg tattgagatc       480
     aaccagctgg atctcacaat agaccaacag caagttaaat tagcaaaatt tcggaccgca       540
     cttactttaa acaatgagca aggtttaact ttactgccca cagaaattaa tggtttaacg       600
     atagttcacc gacatctcac agaaaaaaca acgaagaaga aaaagagtga aaaaactgta       660
     agatcccctg ttgattggga aaaacttaca caacagttaa atcaaccgtt attgcctgat       720
     atgcccgaaa ttgagctacc ttttgatcta catattcaag gtattcaagg aaaaaattgg       780
     ctatatcaac aaattggtaa ttcaaatata ccgcaaagtg atttacacca aattgaaata       840
     tcaactattt atttacacgc agacagtata gataattcta ttcaattaca aacgtttcaa       900
     cttgaaagta atttaggtca gctacgaggt gaggggacat tgcgactcaa gcaagaattt       960
     ccgatagaac tacaagttca agcaacgctc aatgaactta aacatgatgg aaaattgctt      1020
     ttgcctcaca gtaacatcaa ttttacatta agtggaaatc ttaaaaaaca aaccgcactt      1080
     ttcctgcaaa ctcagggaac gcttgagtcg atattacagg gtaaaattga gctttattca      1140
     caaaaaacac cgtttgacat tgaattaaaa gtaataaacg gacaatatcc ctttgagaaa      1200
     aactctacag atccattgaa aattcaggac atgtttttta ctgcaaaagg agatttgctc      1260
     aattatcaag ccacattaca aggcaagctc attggtatgg gaatgcctga aaccaatgtg      1320
     gatttagtac tacaaggcgg attgacacaa tttaccttac aacaacttcg agttaatgcg      1380
     ttaaatatga aggcgaatgc aaacgccaat gtgagctgga aagataaact taagttgaaa      1440
     agcaatattg atctaaaagg acataatgtt cggctaaata atatgcgaat taacaaaatt      1500
     gatttattgg ctaacattag tttacaagat atagtgcaag gacaagtcga tcttgatatt      1560
     gatggtttca gtttaaataa tattaaattg aacagcacta aattacaaat taagggaacg      1620
     gaacaacaac actatttaat ccttaaatca aagggcgagc cggcttcagc aaccttaaat      1680
     ttacaaggga aatttgaccg cactttacaa caatggcaag gtattttaag tcaagtgaat      1740
     attcattctt taattggcaa tttgaccaat agtgaaaata ttttgttgtc ttatgataat      1800
     aaaaagacaa ttgcacaagt ttctgcccat tgctggagat catcggatat tcatctctgt      1860
     tttcaacaag agttcattgt aggaaaaacc ggagaaattc cgtttgattt taaaacaatt      1920
     aatttagcgt tagtgaataa attgatctca caagagattt tcaaaggaca tttatccggt      1980
     caaggaaaat tcgcatggtt tacggagagt tctccttatt tgacgctaca acttaaaggc      2040
     gataatctca atgtggcaaa aaaattagat tatcgtactt ttcgtttagc tatcccaact      2100
     ttaaatataa ctacagagtt acaaaacaat aacttaaccc taaattctaa ttttaatatt      2160
     caaaaccgag gagacgttaa tatggaatta aaattagctg atttaaccaa tcagaaaagg      2220
     ttaagtggtc atttaaaaat tagcgatatg aatttaaata tagttaatca gttaatcgct      2280
     agcagtgaga aagtagatgg tcaagtcaat gcaaagttga gttttgcagg tgatttaagt      2340
     aatcctcttt tgaatggtga atttgctgtg agtcaagttc gagctaagtt gaaatcagtt      2400
     ccttttggta taacaaatgg aaatattata ctaagctttt atggtgatcg ttcaattcta      2460
     aaaggaaata ttcaaactca cgaaagtcat ttaaatattg aaggtcaagc aaattggcgt      2520
     aagctcgacg attggcaagc aggtttacat attaatgcag ataaatttaa ggtggatatt      2580
     ccttccatag ctaaattaca ggtatcgcca aatattgaaa ttcatgcaac acctaaacta      2640
     ttagcgttaa gtggtaatgt tgatattcca tgggcaagga tcgaaattga acgtttacct      2700
     gacaatatag ttgctcccag taaggatgaa gtgattttag atggtcccca aaaaactaaa      2760
     gtagttaaat tgatgaaagg agaaattgag acaactacaa agagtggtat acaaattcac      2820
     tctgacttaa aaatcaagct cggcgatcat gtgcgtttag aggcatatgg tctgaaaacc      2880
     gaattaaatg gcttgctttc agtaaaacaa gaaaaaggca accttggctt atttggacaa      2940
     attaatttac acaatggtca ttatgaatct tttggacaag atcttttaat tcgtaaaggg      3000
     attattagct tttccggttt accttctcaa cctatgttaa atatagaagc aatacgaaat      3060
     ccgacatcaa tggaaaatac gaatatgaca gtaggtgcaa aaatagttgg tattgccgat      3120
     agtcctgaaa tcactatatt ttccgagcca agtacctctc aagatcaagc actctcttac      3180
     cttcttaccg gacgatcttt agaaaatagc ggaaataatg gttccggtgg ctcacttggt      3240
     gctgcattat taggaatagg gttagctaag agtggaaaat tagtcggtgg tattggtaaa      3300
     gtatttggta ttcaaaattt gaacttggat acttctggtg ttggcgacag ttcaaaagtt      3360
     gtcgtaagcg gtaatattac ccctacatta cagataaaat atggtattgg tttattcgat      3420
     ggattggctg aattgaccct acgttatcgc ctattaccta aactttattt acaatccgtt      3480
     tccggtataa accaagcagt cgatctactt tatcaatttg aattttaa                   3528
//

If you have problems or comments...

PBIL Back to PBIL home page