(data stored in ACNUC7421 zone)

EMBL: CP000947.PE21

CP000947.PE21        Location/Qualifiers
FT   CDS_pept        complement(17359..18522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0021"
FT                   /product="Glycerol-3-phosphate dehydrogenase (NAD(P)(+))"
FT                   /EC_number="1.1.1.94"
FT                   /note="PFAM: NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase domain protein; KEGG: hso:HS_0155
FT                   glycerol-3-phosphate dehydrogenase (NAD(P)+)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31832"
FT                   /db_xref="GOA:B0UUX9"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUX9"
FT                   /protein_id="ACA31832.1"
FT                   /translation="MPYLLSICNVNKHKRSQKLKKKKRKKFINLSGCCNNTLIFLLIPK
FT                   ILRKNMNDNSPSPTPITVIGAGAYGTALAIAFSRNGYPTYLWGHRPQHCQRLRNERKNQ
FT                   AFLPNIHFPDSLYVEDNLAQAIQHSRELLIVVPSHVFGDVIMQIKPHLRSDQRIAWATK
FT                   GLERNTGRLLQEVVEEHVGYGYPLAVLSGPTFAKELAAGMPTAITLASNNEQFALEFQE
FT                   RIHCSKFRVYVNQDMIGVQLGGAVKNVIAIAAGISDGMGFGANARTALITRGIAEISRL
FT                   GISLGANPNTFMGTSGLGDLVLTCTDNQSRNRRFGLMLGQGFDCTTAINELGPVIEGFY
FT                   NTKETFLLAQQQGVEMPITEQVYQILFCGKKPEDAAITLLGRKRKRE"
     atgccttatt tgttgagtat atgcaacgtc aacaagcaca agaggagtca aaaactgaag        60
     aaaaagaaaa gaaagaagtt cattaatctt tcagggtgtt gtaataacac cctaatattt       120
     ctattaattc cgaaaattct aagaaaaaat atgaatgata acagtccttc tccaactcca       180
     atcaccgtaa ttggtgccgg tgcttatgga actgccttag ctattgcctt ttctcgcaat       240
     ggctatccaa cctacttatg gggacatcgt cctcaacatt gtcaacgctt acgtaatgag       300
     cgaaaaaatc aagcattttt acctaatatt cactttcctg attctttata tgtagaagac       360
     aatttagcac aagccattca acactccaga gagttattaa ttgttgtacc aagtcatgtt       420
     tttggcgacg ttatcatgca aattaaaccg cacttaagat cggatcaacg tatcgcttgg       480
     gcaacgaaag gactggagcg aaatacagga cgcttattac aagaagttgt tgaagagcat       540
     gtaggatatg gttatccttt agcagtctta tcaggaccta cctttgctaa agaattggct       600
     gccggcatgc cgacagctat tacattagcc tcaaataacg aacaatttgc cttagagttc       660
     caagaaagaa ttcattgtag caaattccga gtctatgtta atcaagatat gattggtgta       720
     caacttggag gggcggttaa aaatgtaatt gctattgctg cagggatttc tgatggtatg       780
     gggtttggtg ctaatgcacg tacagcatta attactcgag gaatcgctga aatcagtcgt       840
     ttgggcatat ctctaggtgc gaatccgaat acgtttatgg gaacatccgg cttaggggat       900
     ttagtcctta cttgtaccga taaccagtct cgtaaccgtc gttttggatt aatgttagga       960
     caaggttttg attgtacaac ggctatcaat gaacttggtc cggttataga gggtttttac      1020
     aatacaaaag aaaccttttt attagcccag caacagggtg tagaaatgcc gattaccgag      1080
     caggtatatc aaatactatt ttgtggtaaa aaacctgaag atgcggctat tactttattg      1140
     ggaagaaaac gcaaaaggga gtaa                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page