(data stored in ACNUC7421 zone)

EMBL: CP000947.PE210

CP000947.PE210       Location/Qualifiers
FT   CDS_pept        complement(229886..231130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0214"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   ClpX"
FT                   /note="TIGRFAM: ATP-dependent Clp protease, ATP-binding
FT                   subunit ClpX; PFAM: AAA ATPase central domain protein; zinc
FT                   finger C4 domain protein; ATPase AAA-2 domain protein;
FT                   SMART: AAA ATPase; KEGG: hso:HS_1433 ATP-dependent Clp
FT                   protease, ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31837"
FT                   /db_xref="GOA:B0UW19"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UW19"
FT                   /protein_id="ACA31837.1"
FT                   /translation="MTKEKELHCSFCGKEQKEVDKLIAGTSGYICNECIELCHDMLANA
FT                   DDIEEIDEEFQEEEPKLPTPHEIRAHLDDYVIGQDYAKKVLAVAVYNHYKRLRSEKNTS
FT                   EVELGKSNILLIGPTGSGKTLLAQTLARMLNVPFAMADATTLTEAGYVGEDVENVLQKL
FT                   LQNCDYDIEKAQQGIIYIDEIDKITRKSENPSITRDVSGEGVQQALLKLVEGTVASIPP
FT                   QGGRKHPQQEMLRVDTSKILFICGGAFAGLDKIIEKRTNTSGKGIGFGADVRIDEEKVS
FT                   LTELFKQVEPDDLMKFGLIPEFIGRLPVIAPLSELDEEALVKILTEPKNALTKQYQVLF
FT                   SLENIELEFTQEALIAMAKKALARKTGARGLRSIVETLLLDTMYDLPSIENLQKVIVEE
FT                   ETVTENKVPVLKFNS"
     atgacaaaag aaaaagaatt acattgctct ttttgtggta aggaacaaaa agaagtagat        60
     aaattaattg caggcacatc cggttatatt tgtaatgagt gtattgaatt atgtcatgac       120
     atgttagcta atgcggatga catcgaagaa attgatgaag aatttcaaga ggaagagcct       180
     aaattaccga caccacatga aattcgtgca catttagatg attatgtcat aggccaagat       240
     tatgctaaaa aagtattagc tgtggcggtg tataatcatt ataaacgttt acgtagcgaa       300
     aaaaatactt ctgaggttga attgggcaaa agtaatattt tgcttatcgg cccgacaggc       360
     agtggcaaga ctttattggc acaaacgtta gctcgtatgc tcaatgttcc ctttgcaatg       420
     gcagatgcaa caactttaac tgaagcggga tatgttggtg aagatgttga aaatgtcttg       480
     caaaaattat tacaaaattg tgattatgat atagagaaag ctcaacaagg tattatctat       540
     attgatgaaa ttgataagat tacacgtaag tctgaaaatc cttctattac tcgtgatgta       600
     tcaggcgaag gtgtgcagca ggctttacta aaattagttg aaggaacggt agcttctatt       660
     cctccacaag gcggacgaaa gcatcctcaa caagaaatgt tgcgtgtgga cacctctaag       720
     attttattta tttgtggcgg tgcttttgcc ggtttagata aaattattga gaaaagaacg       780
     aataccagtg gcaaaggtat tggttttggt gctgatgttc gtattgatga agagaaagtc       840
     agtttaaccg aattatttaa gcaagttgaa cctgatgatt taatgaaatt tggcttaata       900
     ccggagttta tcggtcgttt acctgttatc gcacctttaa gcgaactgga tgaggaggct       960
     ttggtaaaaa ttttaactga gccgaaaaat gccctaacta agcaatatca agttttattc      1020
     agcttagaaa atattgaatt agaatttacc caagaagcat tgattgcaat ggcgaaaaaa      1080
     gcactagctc gtaaaacagg tgccagaggt ttgcgatcta ttgttgaaac cctattgctt      1140
     gatactatgt atgatctccc ttctattgaa aacttacaga aagttatagt ggaagaagaa      1200
     acagtcaccg aaaataaagt gccagtattg aagttcaata gttaa                      1245
//

If you have problems or comments...

PBIL Back to PBIL home page