(data stored in ACNUC7421 zone)

EMBL: CP000947.PE211

CP000947.PE211       Location/Qualifiers
FT   CDS_pept        complement(231146..231727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0215"
FT                   /product="ATP-dependent Clp protease, proteolytic subunit
FT                   ClpP"
FT                   /EC_number="3.4.21.92"
FT                   /note="TIGRFAM: ATP-dependent Clp protease, proteolytic
FT                   subunit ClpP; PFAM: peptidase S14 ClpP; KEGG: hso:HS_1432
FT                   ATP-dependent Clp protease, proteolytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31838"
FT                   /db_xref="GOA:B0UW20"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UW20"
FT                   /protein_id="ACA31838.1"
FT                   /translation="MSVIPMVVEQTSRGERSYDIYSRLLKERVIFLTGEVEDRMANLIV
FT                   AQLLFLEAEDPAKDINIYINSPGGSVTAGMAIYDTMQFIKPNVRTLCIGQACSMGAFLL
FT                   AGGTAGKRAALPHARVMIHQPLGGFRGQASDIQIHAQEILKIKQTLNERLAFHTGQSIE
FT                   QIEQDTDRDNFMSAEQAKLYGLVDDVLIKR"
     atgagcgtca ttcctatggt cgtagaacaa acatcaagag gcgaacgatc ttatgatatt        60
     tattcacgtc tattaaaaga gcgggtgatt tttctgactg gagaagttga agatcgtatg       120
     gcaaacttga ttgttgctca acttctcttt ttggaagcgg aagatccagc aaaagacatt       180
     aatatttata taaactctcc cggcggttca gtcactgccg gaatggcaat ttatgatact       240
     atgcaattta ttaagcctaa tgtgagaact ctttgtattg gacaagcatg ttcaatggga       300
     gcatttttat tggcgggtgg cacagcaggt aaaagggcgg cattgcctca tgcaagagtg       360
     atgattcatc agcctttagg tggctttaga ggacaagcct ctgatattca aattcatgca       420
     caagaaattt taaaaattaa gcagacgtta aatgaacgtt tagcatttca tacaggacaa       480
     tctattgaac aaattgaaca agatactgat cgtgataatt ttatgtctgc agaacaggca       540
     aaattgtacg gtttagttga tgacgtgtta attaaacggt ag                          582
//

If you have problems or comments...

PBIL Back to PBIL home page