(data stored in ACNUC7421 zone)

EMBL: CP000947.PE212

CP000947.PE212       Location/Qualifiers
FT   CDS_pept        complement(231813..233111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0216"
FT                   /product="trigger factor"
FT                   /note="TIGRFAM: trigger factor; PFAM: peptidylprolyl
FT                   isomerase FKBP-type; trigger factor domain protein; trigger
FT                   factor domain; KEGG: hso:HS_1431 FKBP-type peptidyl-prolyl
FT                   cis-trans isomerase, trigger factor"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31839"
FT                   /db_xref="GOA:B0UW21"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UW21"
FT                   /protein_id="ACA31839.1"
FT                   /translation="MSFNIETTQGLERRVNITVPSEAVEQAVREELKRVAKNARIDGFR
FT                   KGKVPAQMIEKRFGASVRQDVLGDLLQKHFFNVMLENKVNLAGRPEFTVEQFEAGKELK
FT                   FTATFEVYPEVQLQGLDKIKVEKPVVEISDADIDKMLDILRKQQATWIETQDVAKADDR
FT                   VTIDFVGSVDGEEFEGGKSTDFVLAMGQGRMIPGFEEGIIGHKAGEQFEINVTFPETYH
FT                   AENLKGKAAKFSITLKKVEVMQLPELTDEFVAKFGPNTKNVADLRNEIAKNMQRELKNA
FT                   LVSRIKTQVIDGLLEQNPIEVPTAAVEQEIEVLRNQAAQRFGGNAQQAAQLPRELFEEQ
FT                   AKRRVQVGLLFSEVISSNELKADEERVKAMIADIASAYEQPAEVIEYYSKNKELMNNIR
FT                   NVVLEQQAVDAVLTKAQVTEKASSFDEVMNPQA"
     atgtcattta atattgaaac aactcaaggt cttgagcgtc gtgtaaatat caccgttcct        60
     tctgaagctg ttgagcaagc tgtgcgtgaa gaattgaaac gtgtagcaaa aaatgcacgt       120
     attgacggtt tccgtaaagg taaagtaccg gcacaaatga ttgaaaaacg ttttggtgca       180
     tctgttcgcc aagatgtatt aggcgattta ttacaaaaac attttttcaa tgtgatgctt       240
     gaaaataaag tgaatttagc cggtcgccca gaatttacag tagaacaatt tgaagctggt       300
     aaagaattaa aatttacagc gacttttgag gtttatccag aggttcagct tcaaggactg       360
     gataaaatca aggttgaaaa accggttgtg gaaatttcag acgccgatat tgataagatg       420
     cttgacattt tacgtaaaca acaagcaact tggattgaaa ctcaagatgt tgctaaagct       480
     gatgatcgtg ttactatcga tttcgttggc tctgttgatg gcgaagagtt tgagggtgga       540
     aaatcaacag actttgtttt ggcaatgggg caaggtcgga tgattcccgg ttttgaagag       600
     ggtatcattg gtcataaagc gggtgaacaa tttgaaatta atgtaacctt ccctgaaact       660
     tatcatgctg aaaatctaaa agggaaagct gctaaatttt cgattacttt gaaaaaagta       720
     gaagtaatgc aattacctga attaacagat gaatttgtgg caaaatttgg ccctaataca       780
     aaaaatgtag cggatttacg caatgaaatt gcaaaaaata tgcaacgtga attgaaaaat       840
     gctttggttt ctcgtattaa aactcaggta attgacggtt tgttagagca aaatccaatt       900
     gaagtaccta ctgccgcagt tgagcaagaa attgaagtat tacgtaatca agcagcacaa       960
     cgttttggcg gtaatgctca acaagctgca caattaccac gtgaattatt cgaagaacaa      1020
     gctaaacgcc gtgttcaggt tggtttatta ttctctgaag tcatctcttc taatgagtta      1080
     aaggctgatg aagaacgtgt taaagcgatg atcgcagata ttgcatcagc ttatgaacaa      1140
     ccagcagaag tgattgaata ttatagtaaa aacaaagagt taatgaataa cattcgcaat      1200
     gtcgtgttag aacaacaagc tgttgatgct gtattaacga aagcacaggt aactgagaaa      1260
     gcgtcttcgt ttgatgaagt aatgaaccct caagcgtaa                             1299
//

If you have problems or comments...

PBIL Back to PBIL home page