(data stored in ACNUC7421 zone)

EMBL: CP000947.PE214

CP000947.PE214       Location/Qualifiers
FT   CDS_pept        complement(234919..236178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0218"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: CBS domain containing protein; protein of
FT                   unknown function DUF21; transporter-associated region;
FT                   KEGG: hso:HS_1429 possible transporter"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31841"
FT                   /db_xref="GOA:B0UW23"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW23"
FT                   /protein_id="ACA31841.1"
FT                   /translation="MDSIPLSTLFITLIILLILSAYFSGSETGVLSVNRYRMRFLAEKG
FT                   HKGAQKTEKLLKRTDVFLSLILICNNLVNISASAIATIIGMRIYGDVGVAVATGLLTFV
FT                   MLIFSEIFPKTIAALYPEKVAFVSSHIISILLKIFSPLVFIINLFISGLMKLFRLKNEV
FT                   KAHSLNSEELRAIVNQSGQYIPSAHQEMLLSILDLEKVTVDDIMVPRNDIAGIDVDDDW
FT                   KAIMRQLNHAAHGRVVLYKGSIDENVLGILRVREAYRLMLDKNEFSKETLIRAVDETYF
FT                   IPEGTELNTQLLNFRNNKERIGLVVDEYGDIKGLVTLEDILEEIVGEFTTSTAPSIDEE
FT                   VTQQSDGTIIIEGSANLRDLNKLFNWNLDTEDARTFNGLILEHLEEIPNEGTECEINGL
FT                   KITVLEVADNMIKQVKVEKV"
     ttggatagta tcccccttag taccttattt attacattaa ttatcttact tattctctca        60
     gcttattttt ccggttctga aacgggagtg ctttccgtta atcgctatcg tatgcgattt       120
     ttagcagaaa aagggcataa aggggcacaa aaaacagaga aattgcttaa gagaacggat       180
     gttttcctca gtctaatttt aatttgcaat aacttagtta atatttccgc atcagcaatt       240
     gcaaccatta taggtatgcg tatatatggt gatgttggcg ttgccgttgc gacaggttta       300
     ttgacctttg taatgttaat tttttcagaa atttttccta aaactattgc cgcactttat       360
     cctgaaaaag ttgcttttgt ttcaagtcat attattagca tactattgaa aatttttagt       420
     ccattagttt ttattataaa tctatttatt agcgggctaa tgaaactttt tcgtttaaaa       480
     aatgaagtaa aagcacattc tcttaactca gaagaattac gtgcaatagt gaatcaatca       540
     ggacaatata tcccttctgc acaccaagaa atgcttcttt ctattttgga cttagagaaa       600
     gttacggtcg atgacattat ggtgccacgt aatgatatag ccggtattga tgttgatgat       660
     gattggaaag cgattatgcg tcagctgaat catgccgctc acgggcgtgt tgtactttat       720
     aaaggcagta ttgatgaaaa tgtactgggt atattacggg ttcgtgaggc ttatcgccta       780
     atgctggata aaaatgaatt tagtaaagaa acgctcattc gtgcagtaga tgaaacttat       840
     tttatccctg aggggacaga attaaatact caattactta atttccgcaa caataaagaa       900
     cgtattggct tggtcgtaga cgaatatggg gatattaaag gactcgtaac gttagaagat       960
     attttggaag aaattgtcgg tgaatttacc acttcaaccg ccccatctat tgatgaagaa      1020
     gtgacacagc aatctgacgg aacaataatt attgaaggat ctgccaattt acgtgattta      1080
     aataaattat ttaattggaa tttagatacc gaagatgccc gcacttttaa tggattgatt      1140
     ttagaacatt tagaagaaat tcctaatgaa ggaactgaat gtgaaataaa tgggctaaaa      1200
     attactgtat tagaagtggc ggataatatg attaaacaag ttaaagttga aaaagtttaa      1260
//

If you have problems or comments...

PBIL Back to PBIL home page