(data stored in ACNUC7421 zone)

EMBL: CP000947.PE215

CP000947.PE215       Location/Qualifiers
FT   CDS_pept        complement(236248..237045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0219"
FT                   /product="cytochrome c assembly protein"
FT                   /note="PFAM: cytochrome c assembly protein; KEGG:
FT                   hso:HS_1428 possible permease"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31842"
FT                   /db_xref="GOA:B0UW24"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW24"
FT                   /protein_id="ACA31842.1"
FT                   /translation="MWFAVISAFFYLISILLIMPMLLGQGGQEVKLNKMAFLVTALIAI
FT                   ISHFIALNKLFIHLFIGNNFTLIEICSLVSAMIAAIATVAILARVKTLWFLLPIVYCFS
FT                   IINLILQALLPEIWVYHLSQNTSLLFHIALSLFAYSVCFIAMLYAIQLRWIDNSLKSKK
FT                   LTFSPVVPPLMTVEKHFFRSLFSGQILLTLTLISGSIQLIDFFSAHNIPKAIFSFLAWF
FT                   VFGIALFGHWKLYWRGKRMIIYTISGMILLTVAYFGSRVILEL"
     atgtggtttg cggttatttc agcttttttt tatttaatta gcattttatt aatcatgcca        60
     atgttattag ggcaaggcgg tcaagaagtt aagttgaata aaatggcttt tttagtcacc       120
     gcactcatcg caattattag ccattttatt gcgttaaata agttatttat tcatttgttc       180
     ataggtaata atttcacgtt aattgaaatt tgctcgttag tgagtgccat gattgctgct       240
     attgcaactg ttgccatttt ggctcgagta aaaacacttt ggtttctgtt gcctatagtt       300
     tactgttttt ctattatcaa tttaatttta caagcattat tacctgaaat ttgggtttat       360
     catttaagtc aaaatacaag tttattattc catattgcct tatctttatt tgcatattcc       420
     gtttgtttta ttgctatgtt gtatgccatt caattacgct ggattgataa tagcttaaaa       480
     agtaaaaaat taactttctc accggttgtt cctccattaa tgaccgttga aaaacatttc       540
     tttcgctctt tgtttagcgg gcaaatatta cttactttga cacttatttc cggtagcatt       600
     caattaattg attttttctc cgctcataat attcccaaag ctattttttc gtttttagct       660
     tggtttgttt tcggtatagc tttatttgga cattggaaat tatattggcg aggaaaaaga       720
     atgattattt atacaatttc aggtatgatc ttgctcactg tcgcttattt cggtagtcgt       780
     gttattttag agttataa                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page