(data stored in ACNUC7421 zone)

EMBL: CP000947.PE216

CP000947.PE216       Location/Qualifiers
FT   CDS_pept        237195..238571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0220"
FT                   /product="signal recognition particle protein"
FT                   /note="TIGRFAM: signal recognition particle protein; PFAM:
FT                   GTP-binding signal recognition particle SRP54 G- domain;
FT                   Signal peptide binding (SRP54) M- domain protein;
FT                   GTP-binding signal recognition particle SRP54 helical
FT                   bundle; SMART: AAA ATPase; KEGG: hso:HS_1427 signal
FT                   recognition particle protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31844"
FT                   /db_xref="GOA:B0UW25"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW25"
FT                   /protein_id="ACA31844.1"
FT                   /translation="MFENLSDRLSKTLRNITGKGRLTEDNIKDTLREVRMALLEADVAL
FT                   PVVREFIHQVKERAIGEEVNKSLTPGQEFLKIVQTELEKAMGVANEKLNLATQPPAVIL
FT                   MAGLQGAGKTTSVGKLAKFLKENYKKKIMVVSVDVYRPAAIKQLETLAQSIGVDFYPSN
FT                   VSQKPVEIARTALAEAKLKFYDVLIVDTAGRLHVDDTMMEEIQQIHTALNPIETLFTVD
FT                   AMTGQDAANTAKAFNEALPLTGIILTKVDGDARGGAALSIRHITGKPIKFLGVGEKTEA
FT                   LEPFHPDRIASRILGMGDVLSLIEDLQRSVDQEKAEKMAKKFKKGDSFTLEDFREQLIE
FT                   MKKMGGMMSMLEKLPGARNLPDHVKSQVDDKMFNKMEAIINSMTLKERANPDIIKGSRR
FT                   RRIALGSGTQVQDVNNLLRQFNEMQRMMKKMRKGGMARMMRGMQGMMGGLGGLGNMFRR
FT                   "
     atgtttgaaa atttatcgga tcgcttgtca aaaaccttgc gtaatattac cggaaaaggt        60
     cgtttaactg aagataatat taaagataca ttgcgtgaag tcagaatggc gttattagag       120
     gctgacgttg ccttacctgt tgtccgtgaa tttattcatc aagtcaagga acgagcgatt       180
     ggcgaagaag tcaataaaag tcttacgcct ggacaagaat ttctcaaaat tgtccaaacc       240
     gaattagaaa aagccatggg ggtggcaaac gaaaaactca atttagccac tcaaccacca       300
     gctgtgattt taatggcagg tttacaaggt gcaggaaaaa caacctccgt cggtaaattg       360
     gcgaaattcc taaaagagaa ctacaaaaag aaaataatgg tagtttctgt cgacgtctat       420
     cgtccggcag caattaaaca gttggaaaca ttggctcaat ctatcggcgt tgatttttat       480
     ccttccaatg tttcacaaaa acctgttgaa attgcacgta ctgcattggc tgaggcaaaa       540
     ctaaaattct atgatgtcct aattgttgat actgccggtc gtttgcatgt agatgacaca       600
     atgatggaag aaattcaaca aattcatacc gcacttaatc caattgagac cctatttact       660
     gtcgatgcta tgactggtca agatgcggca aatacagcaa aagcatttaa tgaggcatta       720
     ccactgacgg ggatcatttt aacgaaagtt gacggtgatg ctcgtggtgg tgcggcactt       780
     tctattcgtc atattaccgg aaaaccaatt aaattcttag gtgtcggtga aaaaaccgag       840
     gcacttgaac cgttccatcc ggatcgtatt gcttctcgta ttttaggtat gggtgatgtt       900
     ctttctttga ttgaagatct acaacgttca gtcgatcaag aaaaagcaga aaaaatggca       960
     aaaaaattca agaaaggaga tagctttact cttgaagatt ttcgtgaaca acttatcgaa      1020
     atgaaaaaaa tgggcggaat gatgtccatg ctggaaaaac taccgggtgc gagaaatctc      1080
     cctgatcatg taaaaagtca agttgatgat aaaatgttca ataaaatgga ggcaattatt      1140
     aattctatga ccttaaaaga gcgtgctaat ccggatatta ttaaaggttc acgccgacgc      1200
     cgaattgcat tgggatcagg tacacaagtg caagatgtga ataatctgtt gagacagttc      1260
     aatgaaatgc agcgtatgat gaaaaaaatg cgaaaaggcg gtatggcgag aatgatgcgt      1320
     ggcatgcaag gcatgatggg gggattaggt ggattaggaa atatgtttag acgttaa         1377
//

If you have problems or comments...

PBIL Back to PBIL home page