(data stored in ACNUC7421 zone)

EMBL: CP000947.PE22

CP000947.PE22        Location/Qualifiers
FT   CDS_pept        complement(18437..18952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0022"
FT                   /product="protein-export protein SecB"
FT                   /note="TIGRFAM: protein-export protein SecB; PFAM: protein
FT                   export chaperone SecB; KEGG: hso:HS_0156 protein-export
FT                   protein, subunit SecB"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31843"
FT                   /db_xref="GOA:B0UUY0"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UUY0"
FT                   /protein_id="ACA31843.1"
FT                   /translation="MTEKNQDAVTEEQGTEVVLQIQRIYVKDVSFEAPNLPHIFQQEWK
FT                   PKLDFNLSTETTHLAEDLYEVCLNISVETTMEGSEDVAFICEVKQAGIFAISGLEDVQL
FT                   AHCLTSQCPNMLFPYARELISSLVNRGTFPALNLAPVNFDALFVEYMQRQQAQEESKTE
FT                   EKEKKEVH"
     atgacagaaa aaaatcaaga tgcagtaaca gaagaacaag gaacagaagt tgttttacaa        60
     attcaacgta tttacgttaa agatgtttct tttgaagcac ctaatctacc gcacattttc       120
     caacaagaat ggaaaccgaa actggatttt aatttaagca cagaaacaac gcatttagca       180
     gaagatcttt atgaagtttg cctgaatatc tctgttgaaa ctacaatgga aggcagtgaa       240
     gatgttgctt ttatctgtga agtaaaacag gcaggcatct ttgctataag cggtttagaa       300
     gatgtacaat tagcacattg cctaacatct caatgcccaa atatgttatt cccttatgca       360
     cgagaattaa tttccagttt agtgaatcgt ggcactttcc cggctttaaa tctagcaccg       420
     gtcaattttg atgccttatt tgttgagtat atgcaacgtc aacaagcaca agaggagtca       480
     aaaactgaag aaaaagaaaa gaaagaagtt cattaa                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page