(data stored in ACNUC7421 zone)

EMBL: CP000947.PE220

CP000947.PE220       Location/Qualifiers
FT   CDS_pept        243084..243500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0224"
FT                   /product="transposase IS200-family protein"
FT                   /note="PFAM: transposase IS200-family protein; KEGG:
FT                   hso:HS_0666 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31848"
FT                   /db_xref="GOA:B0UW29"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW29"
FT                   /protein_id="ACA31848.1"
FT                   /translation="MKKETEIRRGRHVVFNLHVHLVFVTKYRGEVFTQAILNDLHTIFE
FT                   AVCADFEAKLVEFDGEDDHVHLLVEYPPKVAISNLVNSLKGVSSRMIRKKNYPSIRKKL
FT                   WGNQLWSPSYFAGSCGGAPISIIRQYIEQQQTPD"
     atgaaaaaag aaacagagat tagacgtggt cgccacgttg tttttaactt acacgttcat        60
     ttggttttcg tgactaaata tcgcggggaa gtttttactc aagcaatttt gaacgactta       120
     cacaccattt ttgaagctgt ttgtgctgat tttgaagcaa aattagtaga atttgatggc       180
     gaagacgatc acgttcattt acttgttgaa tatccaccga aagtagctat atcaaacctt       240
     gtgaacagtt taaaaggcgt ttcaagcaga atgattagaa agaaaaacta tccgagtatt       300
     cgcaaaaaat tatggggaaa tcagctttgg tctccgtctt attttgcagg aagttgcggt       360
     ggtgcaccca tatctattat tcgccaatac attgagcaac aacaaacacc tgattag          417
//

If you have problems or comments...

PBIL Back to PBIL home page