(data stored in ACNUC7421 zone)

EMBL: CP000947.PE221

CP000947.PE221       Location/Qualifiers
FT   CDS_pept        complement(243787..244248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31849"
FT                   /db_xref="InterPro:IPR009678"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW30"
FT                   /protein_id="ACA31849.1"
FT                   /translation="MRLKYQDLTDHLVAKLPPRYQANFYSWMDDGEMIDEGKIVTDKGE
FT                   ILFYLEYSAELFFHELPFKQINPLQIMAAINLWLAENDLERYMQDEYKTPFDLTLLDDE
FT                   LADLSFTLKFREPIYLNQMTETEKDLDTETEIWTAETVQEIDVLAEIEK"
     atgagattaa agtatcagga tttaaccgat catttagtgg caaaactacc gccacgctat        60
     caagctaact tctattcttg gatggatgat ggcgaaatga tagacgaggg gaaaatcgtt       120
     accgacaaag gcgaaatctt attctacctc gaatatagtg ctgaattgtt tttccatgaa       180
     ttgcctttta aacaaattaa cccgttgcaa attatggcag ccattaactt atggcttgca       240
     gaaaacgatt tagaacgata tatgcaagat gagtataaaa cgccttttga cttaactttg       300
     ctagacgatg aattagcgga tctgagcttt acacttaaat tcagagagcc gatttatctc       360
     aatcagatga cagaaaccga aaaggattta gatacagaaa cagaaatctg gacggctgaa       420
     acagtacaag aaattgacgt tttagcggaa atagaaaaat aa                          462
//

If you have problems or comments...

PBIL Back to PBIL home page