(data stored in ACNUC7421 zone)

EMBL: CP000947.PE223

CP000947.PE223       Location/Qualifiers
FT   CDS_pept        complement(244690..245571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0227"
FT                   /product="phage small terminase subunit"
FT                   /note="PFAM: phage small terminase subunit; KEGG:
FT                   yps:YPTB3143 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31851"
FT                   /db_xref="GOA:B0UW32"
FT                   /db_xref="InterPro:IPR010270"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW32"
FT                   /protein_id="ACA31851.1"
FT                   /translation="MGLREQQARMQELAKLEQAQLNAQANASAEMPSVTQSAVLIALNQ
FT                   DVEKIRQFSAFADRNEYKRTQFLPKWMPFVEQHFNDGRADQNDVIGYCLVYLLDIGHFE
FT                   QAFNLAEKAITNGQRLPERFKSTIPTFMAKHMLDWTIHTTAMGSPVEPYFSQTFEKVAT
FT                   TWQLNEVLVSAWFKQAAIQLLKNATGKAHAASVSDPMRLISAIKLLKKSLYLNPKSGVN
FT                   SLISRCFMRLNALIIGLNDEGINVSDLIDPAQQAALAENNPEIDIKAVIALLNRPPCSF
FT                   DEVVKEMRGKHA"
     atgggattaa gagagcaaca agcaagaatg caagagctgg ctaaattaga gcaagctcaa        60
     cttaacgcac aggctaacgc aagtgcagaa atgccaagtg taacgcaaag tgcggtatta       120
     attgcattaa atcaggacgt tgaaaaaatc cgtcaatttt ctgcttttgc ggacagaaac       180
     gaatacaaac gcacccaatt tttacctaaa tggatgcctt ttgtagagca gcattttaat       240
     gatgggagag cagatcaaaa tgatgttatt ggctattgcc ttgtgtattt gcttgatatt       300
     ggtcattttg agcaagcatt caatttggca gaaaaagcta ttaccaatgg tcaaagattg       360
     ccggaacgct ttaaaagcac aattccaacg tttatggcga aacatatgct tgattggact       420
     attcatacaa cagcaatggg aagtcctgtt gagccgtatt tttcgcaaac attcgaaaaa       480
     gtagcgacga cgtggcaatt aaacgaggtt ttagtttccg catggtttaa acaagcggct       540
     atccagttgc tgaaaaatgc aactgggaaa gctcatgcgg cgagcgtatc cgatcctatg       600
     cgtctaataa gcgctataaa gctattaaag aaaagcctat acctaaatcc taaatccggt       660
     gtaaatagcc ttattagccg ttgttttatg cgtttaaacg cattaataat tggattaaat       720
     gacgaaggca ttaatgtcag cgatttaata gaccccgcac aacaggcggc gttagcagaa       780
     aataatcctg agattgacat caaagcggtt attgccttgc taaatcgtcc gccctgttct       840
     tttgatgagg tggtaaaaga aatgcgaggt aaacatgctt aa                          882
//

If you have problems or comments...

PBIL Back to PBIL home page