(data stored in ACNUC7421 zone)

EMBL: CP000947.PE224

CP000947.PE224       Location/Qualifiers
FT   CDS_pept        complement(245600..246631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0228"
FT                   /product="phage major capsid protein, P2 family"
FT                   /note="TIGRFAM: phage major capsid protein, P2 family;
FT                   PFAM: phage major capsid protein P2; KEGG: pat:Patl_0697
FT                   phage major capsid protein, P2 family"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31852"
FT                   /db_xref="InterPro:IPR006441"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW33"
FT                   /protein_id="ACA31852.1"
FT                   /translation="MNRKQIYNAFIQAIAQHYNVPFAEVRLGEEFSLEAPKAALLGSNI
FT                   QQSSDFLKEINMVQVTDLKGLKLWGATEKGITGRKPTERHIATLNHTQTGYELARTDSG
FT                   ILVPWDMFDQFARFGDKLPALYAEFFNKQVALDMLQVGWHGKSVAPTTSQSDLSDVNKG
FT                   WLALLKEQKSANVYTGNSSHKINLYGTDAEFANLDELALDLKQGLDLRHQNRTDLVFLV
FT                   GADLVNVESKYISKASKLTATERAALGSHNLVNTFAGMRAIIPPNFPAKGAAVTTLNNL
FT                   SIYTQSSSVRRRFESNQDKMGIITSYYRNEGYVVEDTGLMTAIEAENVVIGKPDKPMAQ
FT                   ASD"
     atgaacagaa aacagattta taacgcattt atccaagcta tcgcacaaca ttataacgtt        60
     cctttcgcag aggtgcgttt aggggaagag tttagcttag aagccccgaa agctgcctta       120
     ttgggctcaa atatccagca atccagcgat ttcttaaaag aaatcaatat ggtgcaagta       180
     accgatctca aaggcttgaa attatggggt gcaaccgaaa aaggcatcac aggtcgcaaa       240
     ccaaccgaac gccatattgc aacccttaac catacgcaaa caggctatga gcttgcacgc       300
     acggatagcg gtattttagt accctgggat atgttcgacc agttcgcccg ttttggcgac       360
     aaattaccgg cactttatgc tgagttcttt aacaagcaag ttgccttgga tatgttgcag       420
     gtgggctggc atggtaagag cgtagcacca acgacttcac aaagtgattt atctgatgtg       480
     aataaaggtt ggcttgcact tcttaaagag caaaaatccg ccaatgtgta tacaggtaac       540
     tcaagccata aaataaacct ttacggcaca gatgcagaat ttgccaacct tgatgaatta       600
     gcccttgatt taaaacaagg cttagattta cgccatcaaa accgcacgga tttagttttc       660
     ttggtgggtg cagatttagt caatgtggaa agcaaataca ttagcaaagc atcaaaattg       720
     actgcgacag aacgtgcggc attaggttca cataaccttg tgaatacttt tgcaggtatg       780
     cgagccatta taccgccgaa cttcccggcg aaaggtgcgg cagtaaccac attaaacaat       840
     ctcagtatct atacgcaatc atcaagtgta cgccgtcgtt ttgaaagcaa tcaagacaag       900
     atggggatta tcacaagcta ctaccgcaat gaaggttatg tagtggaaga taccggcttg       960
     atgacggcta tcgaggctga aaatgtagtt atcgggaaac cggataaacc catggcacag      1020
     gcaagcgatt ag                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page