(data stored in ACNUC7421 zone)

EMBL: CP000947.PE225

CP000947.PE225       Location/Qualifiers
FT   CDS_pept        complement(246641..247066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31853"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW34"
FT                   /protein_id="ACA31853.1"
FT                   /translation="MKSPNKKKNHFFSKFFNWLFSGEQPEIKENQENTANTGNPTAIEI
FT                   DNMDKQEFSTLIATAVAGAVAQAFSEQAEQQQEKEQAADKPTEQPAETVSKQEFNELKT
FT                   KYDVLEAKFNQLLQPVTQTPSELGNADNMFNLENSGF"
     atgaaatcac cgaacaagaa aaaaaatcac tttttcagca agttttttaa ttggctattc        60
     agtggcgaac agccggaaat taaagaaaac caagaaaata ccgccaatac aggcaaccca       120
     acagcaatag agattgacaa catggacaaa caagaatttt caactttaat cgctactgca       180
     gtagctggtg cagtagcaca agccttttca gagcaagccg aacagcaaca agaaaaagag       240
     caagcagcag ataaaccaac ggaacaaccc gcggaaaccg ttagcaaaca agaatttaat       300
     gagctcaaaa ccaaatacga tgtattagaa gcgaaattta atcagttatt acagcctgtt       360
     acccaaacac catcggaatt aggcaatgcg gacaatatgt tcaaccttga aaattcagga       420
     ttctag                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page