(data stored in ACNUC7421 zone)

EMBL: CP000947.PE226

CP000947.PE226       Location/Qualifiers
FT   CDS_pept        complement(247017..247538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0230"
FT                   /product="phage capsid scaffolding"
FT                   /note="PFAM: phage capsid scaffolding; KEGG: hch:HCH_00395
FT                   flagellar biosynthesis/type III secretory pathway protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31855"
FT                   /db_xref="GOA:B0UW35"
FT                   /db_xref="InterPro:IPR009228"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW35"
FT                   /protein_id="ACA31855.1"
FT                   /translation="MKTELFTNFVCIATAGATVDGRHIDAQDLKDMAESYNPEVYTALI
FT                   WLEHYRNFGNYGRVVELKTEDEEGKTKLYARLAPNAQLLELNQSGQKIFTSIEITPNFA
FT                   QTGKAYLSGLAITDSPASTGTNALMFNRIGSKDVIISDHLEFNINFPQEVHNMNEITEQ
FT                   EKKSLFQQVF"
     atgaaaacag aactttttac taattttgtt tgtattgcga ctgctggggc aactgttgat        60
     ggtcggcata ttgatgcgca agacctcaaa gacatggcag aaagctacaa tcccgaagtt       120
     tataccgctt taatttggct tgagcactat cgcaactttg gcaactatgg aagggtggta       180
     gagttaaaaa ccgaggatga agagggcaaa accaagctat acgcaagact tgcaccgaac       240
     gcacaattat tagagctaaa tcaatcaggg cagaagattt ttaccagcat tgaaatcaca       300
     ccgaactttg cacaaacagg aaaagcatac ttaagcggat tagccattac tgacagcccc       360
     gcatcaacag gcacaaacgc cttaatgttt aatcgtatcg gctcaaaaga tgtgattatc       420
     agtgatcatc ttgagtttaa tattaatttt ccccaagagg tgcacaacat gaatgaaatc       480
     accgaacaag aaaaaaaatc actttttcag caagtttttt aa                          522
//

If you have problems or comments...

PBIL Back to PBIL home page