(data stored in ACNUC7421 zone)

EMBL: CP000947.PE227

CP000947.PE227       Location/Qualifiers
FT   CDS_pept        247701..249488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0231"
FT                   /product="protein of unknown function DUF264"
FT                   /note="PFAM: protein of unknown function DUF264; putative
FT                   terminase ATPase subunit; KEGG: yps:YPTB3140 possible
FT                   [Haemophilus phage HP1] orf16-like phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31856"
FT                   /db_xref="GOA:B0UW36"
FT                   /db_xref="InterPro:IPR004921"
FT                   /db_xref="InterPro:IPR010332"
FT                   /db_xref="InterPro:IPR035421"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW36"
FT                   /protein_id="ACA31856.1"
FT                   /translation="MPISKLRKRKSKYDDEVIYQARYLYLKKYSPQEIVKELGLNSPRP
FT                   VYYWAEKYNWRNLINEQGIEELIALRIVALIEREGKTDQEIKELESLIEKDLQYKHQRA
FT                   KQAQKTKENSTALFAEETPGRKSKKKAAVKNDISHITDDMFEPFLSSLFDYQLRAREQK
FT                   ALHKVRMILKSRQIGATYYFAFEALEDAIKTGDNQIFLSASKKQAEIFKTYITKMARQY
FT                   FNVELKGNPIILSNGAELHFLSTNKSTAQGYHGHVYGDEFAWLRNFKEFYTVASAMATH
FT                   KKWRETYFSTPSSKLHESYAFWSGDMWKESDKKRRDIVFPSLEQMCNGGVVCPDGAWRY
FT                   VITIHDALKGGAGVLFDLDQLKQKYSALAFKQLFECHWIDDEDSIFTISKLLKCAVNIN
FT                   KWADFQPDTPRPFGDREVWGGYDPAHSSDGASFVIVAPPINEGEKFRVLARYQWFGLSY
FT                   RWQAEQIKKLYQQYNFSYIGIDANGVGQGVFEMIQEFARREARPILYSLETKSGLVLKV
FT                   HDLVERGLIEWSEEEKDIAASFLMIKQTSTQSGAKITFTADRTSQLQHADVFWAIAHAI
FT                   NKKSLIDDRPRRRSVWRIN"
     atgccaataa gtaagctgcg taagcggaaa agcaaatatg acgacgaggt catttatcaa        60
     gctcgttact tgtatttgaa aaaatacagt ccacaagaaa ttgtcaaaga attaggctta       120
     aattcgcccc gtccagtgta ttactgggcg gagaaataca actggcgtaa cttgatcaat       180
     gaacaaggca tagaagagtt aattgcctta cgtattgttg ccctgattga gcgtgagggg       240
     aaaacagatc aggagatcaa agaactagaa agcctaatag aaaaagattt gcaatataag       300
     catcaacggg cgaaacaggc acaaaaaact aaagaaaata gtaccgcact ttttgctgaa       360
     gaaacgccgg gacgaaaaag caagaaaaaa gcagcggtta aaaacgacat atcacatatt       420
     accgatgata tgtttgagcc gtttttgtcc agtttgtttg attatcagtt aagagcaaga       480
     gaacaaaaag cactgcataa agtgcggatg attttaaaaa gccgtcagat tggggcgact       540
     tattattttg cttttgaggc attagaggat gcgattaaaa caggcgataa tcaaattttt       600
     ctctcagcat ccaagaaaca agcggagatt ttcaagactt acatcactaa aatggctcgc       660
     caatatttta atgtcgagct aaaaggcaat ccgattattt taagcaacgg tgctgaattg       720
     catttcttat ctaccaataa aagcacggca caaggctatc atggtcatgt gtacggcgat       780
     gagttcgcat ggttgcgtaa ttttaaagag ttttatacgg ttgcttctgc catggcgacc       840
     cataaaaaat ggcgtgaaac ttatttctct acaccctctt ctaaactgca tgaaagctat       900
     gcattttggt ccggggatat gtggaaagag tcggataaaa aacgccgtga tattgttttt       960
     ccaagccttg aacaaatgtg caatgggggc gtggtttgtc ctgatggtgc ttggcgttat      1020
     gtgataacaa tacatgatgc gttaaaaggg ggtgcgggag ttttatttga cttagatcaa      1080
     ttaaaacaaa aatattcagc cttggcattt aagcagcttt ttgaatgtca ttggattgat      1140
     gatgaagaca gtattttcac tattagcaaa ctgctgaaat gtgcggtcaa tattaataaa      1200
     tgggcggatt ttcagcccga tacgcctcgt ccttttggcg atcgtgaggt gtggggcggt      1260
     tatgatcctg cacatagttc tgatggtgcg tcttttgtga ttgttgcacc accaattaat      1320
     gagggcgaga agtttcgggt tttggctcgt tatcaatggt tcggcttgtc gtaccgttgg      1380
     caagcggagc aaattaagaa actctatcaa caatacaact ttagctatat tggtattgat      1440
     gcaaatggcg taggtcaagg ggtttttgag atgatccaag agttcgcacg gcgtgaggca      1500
     agaccaattt tatatagcct ggaaacaaaa tccgggcttg tacttaaagt tcatgacctt      1560
     gttgagcgtg gtttgattga gtggagcgag gaggaaaaag atattgctgc ctcgtttttg      1620
     atgatcaagc agacctccac acaatccggt gcaaaaatta cctttaccgc agaccgcact      1680
     tcacaattac agcatgcgga tgttttctgg gcgattgctc atgcaattaa taaaaaatcc      1740
     ttaattgatg atagaccaag acgccgctca gtatggcgta taaattag                   1788
//

If you have problems or comments...

PBIL Back to PBIL home page