(data stored in ACNUC7421 zone)

EMBL: CP000947.PE228

CP000947.PE228       Location/Qualifiers
FT   CDS_pept        249499..250527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0232"
FT                   /product="phage portal protein, PBSX family"
FT                   /note="TIGRFAM: phage portal protein, PBSX family; PFAM:
FT                   phage portal protein; KEGG: sgl:SG0244 putative phage
FT                   capsid portal protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31857"
FT                   /db_xref="InterPro:IPR006430"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW37"
FT                   /protein_id="ACA31857.1"
FT                   /translation="MKKQKNTNKPIMFSFQPQGDWELSMPPALDYTGIYFNDFYQCYEP
FT                   PIKRWSLARLPSQNAQHCGILHSRANMIAADYDQGGLSKMDMRAACLNLIQFGDVGLLK
FT                   VRNGFGQVVKLITLSSLYLRKTKEGNYRYLVRRSLTDTEQSDILTYPAQDIIFIKLYDP
FT                   MQQVYGVPDYMGGIQSALLNSDATTFRRRYFANGSHLGFILYTTDPNVTEEMEENINKS
FT                   LNGSQGVGNFKSMFVNSPDGHPDGLKVIPIGDTGKKDEFGTIKNVSAQDVLTAHRYPPG
FT                   LSGVIPQTGSFGDPLKMRLAYRQDEVLPMQDLISSSINGDIEIARNKALQISFKQRQIL
FT                   QK"
     atgaaaaaac aaaaaaatac caataagccg ataatgttct cttttcagcc gcaaggagat        60
     tgggagctat ctatgccacc tgcgttagat tacacaggca tttattttaa tgacttttat       120
     caatgctacg agccgccgat caaacgttgg tcattggcga gattgccttc gcaaaatgca       180
     caacattgcg gcattttgca cagtcgggcg aatatgatag ccgctgacta tgaccaaggt       240
     ggattgtcta aaatggatat gcgtgcggct tgtttgaatt taattcagtt tggtgatgtg       300
     ggattgttaa aagtacgcaa tggctttggg caagtggtta aattaattac gctctccagt       360
     ctgtatttac gcaaaacgaa agagggaaac tatcgctatt tggtgcgtag atcgctcacg       420
     gatacagaac aatccgatat tcttacttat ccggcacaag atattatttt tattaagctc       480
     tacgacccta tgcaacaggt ttatggtgtg cctgattata tgggcggtat tcagtccgct       540
     ttgttgaatt ctgatgctac aacgttcaga agacgctatt ttgctaacgg ttcgcatttg       600
     ggctttattc tctatactac tgaccctaat gtcacggagg aaatggaaga aaatatcaat       660
     aaatccttaa atggttcgca aggcgtgggg aattttaaat cgatgtttgt gaattcgcct       720
     gatggtcatc cggacggatt aaaggttatt cctattgggg atacgggtaa aaaagacgag       780
     tttggaacaa tcaaaaacgt atccgcacaa gatgtattaa ctgcacatcg ttatccaccc       840
     ggattatccg gcgttatacc tcaaacgggg agttttggcg acccgttaaa aatgcgtttg       900
     gcttatcgcc aagatgaagt tttaccgatg caagatttaa tttcatcgtc cattaatggc       960
     gatattgaga tcgcacgaaa taaggcgtta cagattagtt tcaaacaacg tcaaatactg      1020
     caaaaatag                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page