(data stored in ACNUC7421 zone)

EMBL: CP000947.PE23

CP000947.PE23        Location/Qualifiers
FT   CDS_pept        complement(18963..19409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0023"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: hso:HS_0157
FT                   conserved hypothetical protein, with rhodanese-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31854"
FT                   /db_xref="GOA:B0UUY1"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUY1"
FT                   /protein_id="ACA31854.1"
FT                   /translation="MQEYLPLATEFAKNHSLMVIAWIAVFVMLIYTSVKSFTSKVTAVE
FT                   NAEATRLINNEEAIVIDLRTIDEFQRGHIINSINVLPTEIKNQNLGKIEQHKDTPVILV
FT                   CATGMNAGASAELLVKQGFSRVYSLKDGISGWIAANLPLVKKHK"
     atgcaagaat atctcccttt agcaacagag tttgcaaaaa atcatagcct aatggtaata        60
     gcatggattg ccgtatttgt catgttaatt tatacatcgg taaaatcatt taccagtaaa       120
     gttacggcag tagaaaacgc cgaagcgact cgtttaatta ataatgaaga ggctattgtt       180
     attgatttac gcacaataga tgaatttcaa cgtggtcata ttatcaacag tatcaacgta       240
     ttgccaacag agattaaaaa tcaaaattta ggaaaaattg aacaacataa agatacccct       300
     gtaattctag tttgtgcaac aggtatgaat gcaggtgcat cagcagaatt attagttaaa       360
     caaggattta gtcgagttta ctcactgaaa gatggtatca gtggctggat tgcggcaaat       420
     ttacctttag tcaaaaaaca taaataa                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page