(data stored in ACNUC7421 zone)

EMBL: CP000947.PE230

CP000947.PE230       Location/Qualifiers
FT   CDS_pept        complement(250962..251357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31859"
FT                   /db_xref="GOA:B0UW39"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW39"
FT                   /protein_id="ACA31859.1"
FT                   /translation="MKIKMRFLTEVAEIEPRPSKDKIYPIGTIIIQISATRGEVLYLRK
FT                   ESKIEDRYAVISPKEQIQSFYLFSIIEKYFPKFFLQYKQGLNFKAEDLKRFKLPVHEEQ
FT                   KQRNIIAKMMMLCGCEPKKFYENIPTI"
     atgaaaataa aaatgcgatt tttaacagaa gtagcagaaa tagaacctag accaagcaaa        60
     gacaaaattt atccaatagg gacaattatt attcaaatat cagcaacgag aggagaggtc       120
     ctatatttac gtaaagaaag caaaatagaa gatagatatg cagtaatttc cccaaaggaa       180
     caaattcaat cgttttattt gttcagcatt atagaaaaat attttccgaa gtttttttta       240
     cagtataagc aaggattgaa ttttaaagcg gaagatttaa agcgttttaa attgcctgtt       300
     catgaggaac aaaaacaacg gaatatcatt gctaagatga tgatgttatg cggttgtgaa       360
     ccgaaaaagt tttatgaaaa tataccaacc atttaa                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page