(data stored in ACNUC7421 zone)

EMBL: CP000947.PE231

CP000947.PE231       Location/Qualifiers
FT   CDS_pept        complement(251354..252739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0235"
FT                   /product="N-6 DNA methylase"
FT                   /note="PFAM: N-6 DNA methylase; KEGG: ldb:Ldb1052 type I
FT                   restriction-modification system, modification subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31860"
FT                   /db_xref="GOA:B0UW40"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW40"
FT                   /protein_id="ACA31860.1"
FT                   /translation="MKITELLNLKWDYQITEHLINLLFDKQKRNEVFARYLSQKPDLSQ
FT                   DCFLQEFQENFADRKSLKQDFTPSAICQLVSRLTPEVDSVLDVCAGTGALTIAKWKVNP
FT                   NATFYCQEYSKEAIAFLLFNLCVRGITAEVKHCDVLTGETFAEYRLTRNGQYSDIENTK
FT                   LDWRGLKVDCVVSNPPYSAKWNPVSDERFEYFGLAPKNAADYAFVLHGLHHLKEEGTAH
FT                   FILPHGVLFRGNSEGKIRQKLIEQGYFSSVIGLPDNLFISAKIPTAILTFKKQSSDIYV
FT                   IDAADLFEKAKSNNIMRPEHVNQVLTAYQLRHNIDKLAHLANYTEIQQNDFNLNIPRYV
FT                   DKSEPDPEIDLLKEAQELLDLTNDIEKSGQAFVAMLAELEMTHGSAEDKAEFEQVKQIL
FT                   AQVFAPRTKEKKAIQQLISSKQGSLFITEQEVEQFTGFIEHELKIISQLETIKKYFLSK
FT                   MFI"
     atgaaaataa ccgaattact caatttaaaa tgggattatc aaataacaga gcatcttatt        60
     aatctgttat ttgataaaca aaagcgaaat gaagtctttg cgcgatattt atctcaaaaa       120
     cctgatttaa gtcaagattg ttttctgcaa gagtttcaag agaattttgc agacagaaaa       180
     tcattaaaac aggattttac accatcggct atttgccaat tagtgagccg gttaacgcct       240
     gaagtagata gtgtattaga tgtttgtgcc ggtaccgggg cgttaacaat agcgaagtgg       300
     aaggtaaacc ctaatgcgac tttctattgt caagaatatt caaaagaggc aattgcattc       360
     ttgttgttta atctttgtgt gcgtggcatc accgcagaag ttaagcattg tgatgtttta       420
     actggtgaaa cttttgcaga atatagactg acgagaaacg ggcaatatag cgatattgaa       480
     aacacaaaat tagattggcg agggttaaaa gtggattgtg tggtaagtaa tccgccttat       540
     tctgcaaaat ggaatcccgt gagtgatgaa cggtttgaat attttggctt agcacctaaa       600
     aatgcagctg attatgcctt tgttttgcat gggctacatc atttaaaaga ggagggaacg       660
     gcacatttta ttcttcctca cggggtgtta tttcgtggta actcagaagg aaaaatcaga       720
     caaaaactga ttgagcaagg ttatttctcg agtgtgatag gattgcccga taatctattt       780
     atcagtgcaa aaattccaac cgctatttta acctttaaaa agcaaagctc agatatttat       840
     gttatcgatg cagcagattt atttgagaaa gcgaaatcca ataacattat gcgacctgag       900
     cacgtcaatc aagtgcttac cgcttatcaa ttaaggcaca atattgataa gctcgcacat       960
     ttagccaatt acacagaaat acaacaaaat gatttcaatt taaatattcc gcgttatgtg      1020
     gataaatcag agcccgatcc tgaaattgat ttactgaagg aggcacaaga gctactggat      1080
     ttaaccaatg atattgaaaa aagcggtcaa gcctttgttg caatgttggc agaacttgaa      1140
     atgacacatg gcagtgcaga ggataaagcc gaatttgagc aagtaaaaca aattttagca      1200
     caagtttttg caccaagaac gaaagagaag aaagccatac aacagcttat atccagtaag      1260
     caaggctcgc tattcattac tgagcaagaa gttgaacaat tcaccggctt tatcgagcat      1320
     gaacttaaaa ttatttctca acttgaaacc attaaaaaat actttttaag taagatgttt      1380
     atatga                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page