(data stored in ACNUC7421 zone)

EMBL: CP000947.PE232

CP000947.PE232       Location/Qualifiers
FT   CDS_pept        complement(252756..253286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31861"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW41"
FT                   /protein_id="ACA31861.1"
FT                   /translation="MIVNNKWIPEVPRPTLEDDAFAAFIKAWIEEEYPDHCEDIPAEET
FT                   GLYETLLRNWAGFDDLMAEEFIKFHGWSYAQAKEFEEKSLSFAIDKKESEMIQQWVAEN
FT                   GYTLPFPVGSRVKIDTWRGAVYGVIAQNQDQYFSKKGQAIVQIDREHAIEIEGGEVLDK
FT                   RSFPWEMLELVKS"
     atgatagtaa ataacaaatg gatccccgaa gtcccacgcc caacacttga agatgatgcc        60
     tttgctgcat ttattaaagc atggattgaa gaagaatatc ccgaccactg cgaagatata       120
     cccgccgaag aaacaggctt atatgaaacc ctattaagaa attgggcggg attcgatgat       180
     cttatggcag aagaatttat caaattccat ggctggagct atgcacaagc aaaagaattt       240
     gaagaaaaaa gcctttcttt tgctatcgac aaaaaagaaa gcgaaatgat ccaacaatgg       300
     gtagccgaaa acggatatac attgcctttc cccgtagggt caagagtaaa aatagacaca       360
     tggcgcggtg cagtttatgg cgtaatcgca caaaatcaag atcaatattt tagcaaaaaa       420
     ggacaagcaa tagtccaaat tgacagagag cacgcaattg aaatagaagg cggagaagtt       480
     ttagataaaa gatctttccc gtgggaaatg ttggagttag tgaagagttg a                531
//

If you have problems or comments...

PBIL Back to PBIL home page