(data stored in ACNUC7421 zone)

EMBL: CP000947.PE233

CP000947.PE233       Location/Qualifiers
FT   CDS_pept        complement(253301..255490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0237"
FT                   /product="unknown protein"
FT                   /note="KEGG: pmu:PM1782 unknown"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31862"
FT                   /db_xref="InterPro:IPR009270"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW42"
FT                   /protein_id="ACA31862.1"
FT                   /translation="MIVKKKNLKNAPNVKDFKKQAINTTDIAFIIVGEDAWSYAGKKGK
FT                   YILSHYGTLKDKFGVFLPEKPIVLGPKQIEQISSLRIIPENHKKVRIMEAGEFSPIKKT
FT                   ALLLNLAQNSKANDVVFVDLLGEPLEDVSDYLEKLRTDSEDLAFAEQVVGYEPDIETHK
FT                   EPYVDEREEGKLNGLFYVVPKVDRDTGAVINEKLSWICSPLTLVGNGRNDIGDYYYLFK
FT                   WKHFSQKESHIEAVSLADFGTEAGWRQLKRKGLLMTAKNLTNHLVEHFHVLSRQAPFWK
FT                   VTASTGWQDSAYLLPSGEIIGEPSKPIYFNGESGSASGYRTKGTLNDWQREIAQNLKGN
FT                   PSMMLGVAVALAAPLLAILGRDSFGVHLYAESSKGKTTILNIANSLYGDPDKIKLSWSA
FT                   TAVGVKNEAAARNDGLITLDEIGQAKDAKNLEAIAYDLFNETGKLQGKKEGGNKDINRW
FT                   KVTALSTGEKDLETQLALQGVKVHAGQLVRLINIPLEEAKNLHYFTNNKSHADHLNESV
FT                   REYYGTAGREWIAFLAKNAELAKESYKIIRKKWADLADNMSGQVQRVATDRFAVLETAL
FT                   HLASHITQWSIEENQQVILKNFLNWKEEYGENSREETKLIANLMDWITMNEGAFVEYPT
FT                   DQNAKTPNKIYGIKILEDEFRGEGGYFYVIPQAFKEATQGYPRNMALKILANAKILQSP
FT                   TTPEKGYEYQFKVPKKMLGRQIRAYKITPILEETH"
     atgatagtca agaaaaagaa cctcaaaaac gccccaaatg taaaggattt taaaaagcaa        60
     gccatcaata caacagatat tgcttttatt atcgtaggcg aggacgcatg gagctacgca       120
     ggtaagaaag gaaaatatat tctttcccat tatggcacgc ttaaagacaa attcggggta       180
     tttcttcccg aaaagccaat tgttttaggg ccgaagcaaa tcgaacaaat ttcaagccta       240
     cgcattatcc cggaaaacca taagaaagtg cgtataatgg aagcggggga attttccccc       300
     ataaaaaaaa ccgcactttt gcttaacctg gcacaaaaca gcaaagcaaa tgacgttgtt       360
     tttgtggatt tattgggcga acctttagaa gatgtgagcg actatcttga aaagctcaga       420
     acggacagcg aagacttagc ctttgctgaa caagtcgtag gatatgaacc cgacatcgaa       480
     acccacaaag agccttatgt tgacgaacga gaagaaggca agctcaacgg cttattctat       540
     gttgttccca aggtagatcg ggacactggt gccgtcatca atgaaaagct cagttggata       600
     tgcagtccat taacccttgt aggcaacgga cgcaacgaca tcggcgatta ttactatctt       660
     ttcaaatgga aacatttcag ccaaaaagaa agccatatag aagctgtaag ccttgctgac       720
     tttggcacag aagcaggatg gcgacaactt aagcgtaaag ggctactgat gacggccaaa       780
     aatctgacta atcatcttgt agagcatttt catgtgctca gcagacaagc tcccttctgg       840
     aaagtcaccg catcaacagg ctggcaagat agtgcctatt tattgccaag tggcgaaatt       900
     atcggagagc ctagtaaacc tatctatttt aatggcgaaa gcggatccgc atcaggctac       960
     cgcacaaaag gcacattaaa cgattggcaa agagaaatag cacaaaacct aaaaggcaat      1020
     ccatccatga tgctaggcgt tgccgtagca cttgctgcac ctttattagc aattttagga      1080
     cgtgactcat ttggcgtcca tttatacgcc gaaagctcaa aagggaaaac cactattcta      1140
     aatatcgcta atagtcttta tggcgacccg gacaaaatca aattaagctg gagtgcaacc      1200
     gccgtaggcg taaaaaacga agcggcagca cgcaacgacg gcttaattac tttggacgaa      1260
     atcggacaag caaaagatgc taaaaatcta gaagctatcg cctacgacct attcaacgaa      1320
     acaggcaaac tacaaggcaa aaaagagggg ggaaacaaag acataaaccg ctggaaagtg      1380
     accgcacttt caacgggcga aaaagacctc gaaacccagc tcgccttgca aggcgtaaaa      1440
     gtccacgcag ggcaattagt gcggttaatt aatatccctc tcgaagaggc aaaaaaccta      1500
     cattacttta ccaacaacaa aagccacgcc gaccacttaa acgaaagcgt aagagaatat      1560
     tacggcaccg cagggcgaga atggatcgcc tttttggcaa aaaatgcaga gctcgcaaaa      1620
     gaaagctata aaatcatccg caaaaaatgg gcagatcttg ccgacaacat gagtggccaa      1680
     gtgcaacgag tggctactga tcgttttgcc gtgctagaaa ctgcattaca tcttgccagc      1740
     catattaccc aatggagcat cgaagaaaat caacaagtca tattaaaaaa tttcctgaac      1800
     tggaaagagg aatatggcga aaacagccga gaagaaacga aactcatcgc taatttaatg      1860
     gactggataa ccatgaatga aggtgccttt gttgaatacc caacagatca aaacgccaaa      1920
     accccaaata aaatctatgg catcaaaatc ctagaagatg aatttagagg agaaggcggt      1980
     tatttttacg ttatcccaca agcattcaag gaagcaacgc aaggctatcc acgcaacatg      2040
     gcactaaaaa tcctcgctaa tgcaaagata ttacaaagcc caacaacgcc ggaaaaaggc      2100
     tatgaatatc aattcaaagt cccgaaaaaa atgctggggc gacaaatccg tgcttacaaa      2160
     atcaccccaa ttttagaaga aacccactaa                                       2190
//

If you have problems or comments...

PBIL Back to PBIL home page