(data stored in ACNUC7421 zone)

EMBL: CP000947.PE234

CP000947.PE234       Location/Qualifiers
FT   CDS_pept        complement(255487..255756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31863"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW43"
FT                   /protein_id="ACA31863.1"
FT                   /translation="MSKSSVVRFAMEAQLKETISTLNAYVDYLFEIQHIGASSDSPEFN
FT                   HKKSDRYFIAMDNLCYTLDMHLKSWREIAQNEQLGRYSTSREEI"
     atgtctaaat cttctgttgt acgttttgcc atggaggcac agctcaaaga aacaatttca        60
     accttaaatg cctacgttga ttatctcttt gaaatccaac atatcggtgc aagctccgac       120
     agccccgagt ttaatcataa aaaaagcgac cgctatttta tcgccatgga taacctttgt       180
     tataccttgg atatgcacct taaaagctgg cgtgaaatcg cccaaaatga acagctggga       240
     cgctattcaa cctcaaggga agagatatga                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page