(data stored in ACNUC7421 zone)

EMBL: CP000947.PE236

CP000947.PE236       Location/Qualifiers
FT   CDS_pept        complement(256389..256667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0240"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_0527 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31866"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW45"
FT                   /protein_id="ACA31866.1"
FT                   /translation="MMSNTNYQANQENAFKPDLEGIKNTLETSRDLIIQLKEKKPVMAF
FT                   NDEGQEVQLSQEKILDIVLTQLFCSIDDIDEIQSKRLEPIAKTIEEP"
     atgatgagta atacaaatta tcaagcaaac caagaaaacg catttaagcc cgatttagag        60
     ggtattaaga acacattaga aacctcaaga gatttaatta ttcagttaaa agagaaaaag       120
     cccgtaatgg cttttaatga cgaggggcaa gaggttcagt tatctcaaga aaaaatacta       180
     gacatagtac taacgcaatt attctgttct attgacgata ttgacgaaat acagagtaag       240
     cgattggagc cgatagcaaa aacgatagaa gaaccctaa                              279
//

If you have problems or comments...

PBIL Back to PBIL home page