(data stored in ACNUC7421 zone)

EMBL: CP000947.PE237

CP000947.PE237       Location/Qualifiers
FT   CDS_pept        complement(256736..257500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0241"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   hit:NTHI1495 modification methylase DpnIIB-like"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31867"
FT                   /db_xref="GOA:B0UW46"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW46"
FT                   /protein_id="ACA31867.1"
FT                   /translation="MEHIKRTQKCELFNDHFQNYKRYHIPKAQLVIADIPYNVGNNAYA
FT                   SSPEWYKDGDNKNGESDKANKAFFDTDENFRIAEFMHFCSKMLVKEPKERNQAPCMIVF
FT                   CAFQQIQMVLEYAEKYGFKKHIPLVFIKSSSPQVLKANMKVVGATEYALILYREKLPKF
FT                   RNNGKMIKNWMEWTRDDRKKYPKLHPTQKPIDVLKRLIEIFTDEGDVVIDPVAGSGSTL
FT                   RAARELGRNSYGFEIKKDVYQNAKENMLKEGD"
     atggaacaca tcaaacgcac ccaaaaatgc gaacttttta acgaccattt ccaaaactat        60
     aaacgctacc atatcccaaa agcccagctt gtcattgcgg atattcccta taacgtaggc       120
     aataacgctt atgcaagtag tccggaatgg tacaaggacg gcgataataa aaacggcgaa       180
     agcgacaaag ccaacaaagc cttttttgac acagatgaaa actttcgcat tgcggaattt       240
     atgcatttct gttcaaaaat gcttgttaaa gagccaaaag agcgtaatca agcgccttgc       300
     atgattgtgt tctgtgcatt ccaacaaatc caaatggtcc ttgaatatgc ggagaagtat       360
     ggctttaaaa agcatatccc cttggtattt atcaagtctt caagcccaca agtcttaaag       420
     gcaaacatga aagttgtcgg tgcaacagaa tacgccttaa ttctttaccg cgagaaattg       480
     ccgaagtttc gcaacaacgg aaagatgatc aaaaactgga tggaatggac aagggacgac       540
     cgcaagaaat acccaaaatt acacccaacc caaaaaccaa tcgatgtatt aaagcgtctg       600
     attgagattt ttaccgacga gggcgatgtt gtcatcgatc ctgttgcggg gagtggctca       660
     acgcttagag cagcaagaga actggggcgt aatagttacg gttttgaaat taaaaaagac       720
     gtttatcaaa acgcaaaaga aaatatgtta aaagagggtg attaa                       765
//

If you have problems or comments...

PBIL Back to PBIL home page