(data stored in ACNUC7421 zone)

EMBL: CP000947.PE238

CP000947.PE238       Location/Qualifiers
FT   CDS_pept        complement(257511..257972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0242"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pmu:PM1778 unknown"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31868"
FT                   /db_xref="InterPro:IPR018880"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW47"
FT                   /protein_id="ACA31868.1"
FT                   /translation="MNMHLKKTSAEPQNSNVRQTANSSTPLNRAFFIRTLRTSQINPFA
FT                   YGAKCLISMVAYHGKGFALCCVPFDAVSELMIRCRQYQSLRTLRAVTPKNTNGVTLMIY
FT                   KFILLGKNRLHLSIFANNEQQARNRVNLSNAICYARINPKQYRTLSGNA"
     atgaatatgc acttgaaaaa aacaagtgcc gagcctcaga actcgaacgt tagacaaacg        60
     gcgaatagta gcacgccttt aaaccgtgct ttttttattc gtaccctacg cacatctcaa       120
     attaatccct ttgcttatgg tgcaaagtgt ttaatctcaa tggtagcgta tcatgggaaa       180
     ggtttcgccc tttgctgtgt accgtttgac gcagtttctg agctcatgat acgttgccgc       240
     caatatcaaa gcctcagaac tttgcgtgcg gtaactccta aaaacacaaa cggagttaca       300
     ctcatgatct acaaattcat tttactaggc aaaaaccgcc tacacctcag tattttcgcc       360
     aacaacgagc aacaagcccg caaccgcgta aacctcagta atgcaatttg ctacgctcga       420
     attaacccaa aacaataccg cactttaagc ggtaatgcat aa                          462
//

If you have problems or comments...

PBIL Back to PBIL home page