(data stored in ACNUC7421 zone)

EMBL: CP000947.PE239

CP000947.PE239       Location/Qualifiers
FT   CDS_pept        complement(258443..258724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0243"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31869"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW48"
FT                   /protein_id="ACA31869.1"
FT                   /translation="MSYTNKKNRTNRIAGANGKPPSPRIAQHQINFIKTLLYLHYNIKT
FT                   PQQARNALRNGKLGQDLERLRNQHGDILANLNMAIPSDVTLENWYNQA"
     ttgagctata ccaacaaaaa aaacagaact aaccgcatcg caggggcaaa tggcaaaccg        60
     ccaagccccc gtattgcaca acatcaaatt aatttcatca aaaccctatt atatctccac       120
     tacaacatca aaaccccaca acaagcccgc aacgccctac gcaatggcaa gctcgggcaa       180
     gacctcgaac gcctaagaaa tcaacatggc gatatactag caaatctcaa catggcaatc       240
     ccctccgatg taacccttga gaactggtac aaccaagcct aa                          282
//

If you have problems or comments...

PBIL Back to PBIL home page