(data stored in ACNUC7421 zone)

EMBL: CP000947.PE240

CP000947.PE240       Location/Qualifiers
FT   CDS_pept        complement(258693..258962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31870"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW49"
FT                   /protein_id="ACA31870.1"
FT                   /translation="MAPILNNPLKKIKEKTMANSNTEHSKKLRAQTAKERNQRLKAEGK
FT                   VRQISMLINSELADQFDVIAKEQGKSRPEVLKMLIELYQQKKQN"
     atggctccaa tcttaaacaa cccacttaaa aaaatcaagg agaaaaccat ggcaaattca        60
     aacacagaac atagtaaaaa gctcagagca caaaccgcaa aagaacgcaa tcaacgccta       120
     aaagctgaag gcaaagtacg ccaaattagc atgctcatca atagcgaact ggcggaccaa       180
     ttcgatgtaa tcgccaaaga acaaggcaaa agccgtcccg aagtgcttaa aatgctcatt       240
     gagctatacc aacaaaaaaa acagaactaa                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page