(data stored in ACNUC7421 zone)

EMBL: CP000947.PE241

CP000947.PE241       Location/Qualifiers
FT   CDS_pept        259257..259694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0245"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vei:Veis_1323 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31871"
FT                   /db_xref="InterPro:IPR025272"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW50"
FT                   /protein_id="ACA31871.1"
FT                   /translation="MAYSAMQVANAFIQKAQEGKVPALTPMKLQKLMFFAQSWYLKKYH
FT                   VRLIDDHFVRWQYGPVIPSVYYEFSSFGSCDINQPATNPFGIIAPNLTIADDAFIDEVI
FT                   ATYGSFDGWKLSVMTHQPKTAWSMGKIGSVITPIEMFEGKV"
     atggcttatt ctgctatgca agtggcgaat gcgtttattc agaaagcaca agaggggaaa        60
     gtccctgcac ttacgcctat gaagttgcaa aaattgatgt tttttgcaca atcttggtat       120
     ttgaaaaaat atcatgtgcg tcttattgat gatcattttg tgcgttggca atatggtcct       180
     gttattcctt ctgtgtacta tgaattttcg agttttggat cttgtgatat taatcaacct       240
     gctactaatc cttttgggat tattgcacct aatttgacta ttgctgatga tgcttttatt       300
     gatgaggtca ttgcaactta cggtagcttt gatggttgga aattgtcggt tatgacgcat       360
     cagcctaaga cggcttggag tatgggaaag attggctctg ttattacgcc aatagagatg       420
     tttgaaggga aagtataa                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page