(data stored in ACNUC7421 zone)

EMBL: CP000947.PE243

CP000947.PE243       Location/Qualifiers
FT   CDS_pept        complement(262158..262610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0247"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nma:NMA1837 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31873"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW52"
FT                   /protein_id="ACA31873.1"
FT                   /translation="MQEVEVISTALNFCHEFGLTKKSRKKCEKVFQQIEERSNFIINLS
FT                   IKSDEEWKETTGNLTRGHFDPSTFTITIPESIYELACRGDRTSLFIIFHEFGHLFLGHR
FT                   AVLHNAKVPPTKNEDAEWQADTFAEIVLERLGFYTSPQLELDFGGM"
     atgcaagaag ttgaagttat atccaccgcc ttgaactttt gccacgaatt cggacttaca        60
     aaaaaatcac gcaagaaatg cgagaaggtt tttcagcaaa ttgaggagag aagtaatttt       120
     attatcaatt tgtctataaa atcagatgaa gaatggaagg aaacaacagg gaatttaacg       180
     cgaggtcatt ttgatccaag tacttttaca ataactattc ctgaaagtat ttatgagtta       240
     gcttgtagag gtgatagaac atctttattc attatatttc atgaatttgg tcatttgttt       300
     ttaggtcata gggcggtatt gcataatgca aaggttccac cgacaaagaa tgaagatgct       360
     gaatggcaag ctgatacatt tgcagaaata gttttagaac gattaggatt ttacacatca       420
     ccgcaattag aacttgattt tggcggaatg taa                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page