(data stored in ACNUC7421 zone)

EMBL: CP000947.PE244

CP000947.PE244       Location/Qualifiers
FT   CDS_pept        complement(262646..263011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0248"
FT                   /product="conserved hypothetical DNA-binding protein"
FT                   /note="KEGG: nma:NMA1838 hypothetical DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31874"
FT                   /db_xref="GOA:B0UW53"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW53"
FT                   /protein_id="ACA31874.1"
FT                   /translation="MALTEFGKIVRKARIDANETLLTMSKALGTTPAYLSGLETGSKKI
FT                   SKKWVVAITHFFKEKGIEVKELQKLADVSNENVPIDGLSEHHKMLVAGFANSRYTAKEL
FT                   AQISELLTRINHEKDSK"
     atggctctta cagaatttgg caaaatagtt cgtaaggcta gaattgatgc taatgaaacc        60
     ttactcacaa tgtcaaaagc attaggaact acaccggctt atttaagcgg attagaaaca       120
     ggaagtaaaa aaatatctaa aaaatgggtc gttgcgataa ctcatttttt taaagagaaa       180
     ggcatcgagg tgaaagaatt acaaaaatta gccgatgttt ctaatgaaaa tgttccgata       240
     gatggtttat ctgaacatca caagatgcta gtggctggat tcgctaattc acgttatacc       300
     gctaaagaac tagctcaaat ttctgaatta ttaactcgta ttaatcatga aaaggatagt       360
     aaatga                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page