(data stored in ACNUC7421 zone)

EMBL: CP000947.PE245

CP000947.PE245       Location/Qualifiers
FT   CDS_pept        263373..263696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0249"
FT                   /product="Addiction module killer protein HI1419"
FT                   /note="TIGRFAM: Addiction module killer protein HI1419;
FT                   PFAM: protein of unknown function DUF891; KEGG:
FT                   bxe:Bxe_B0862 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31875"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="InterPro:IPR014056"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW54"
FT                   /protein_id="ACA31875.1"
FT                   /translation="MYSIKQTSIFKQWLKNIKDPIARIMVIKRIERAKNGNFGDHKLLA
FT                   NTGGIYEMRIDTGKGYRIYYAKIEDIIYLLTNGGDKKTQQQDISDAQVILEKFKQLGDD
FT                   ENE"
     atgtactcaa taaaacagac atcaattttt aagcaatggt tgaagaatat aaaagatcct        60
     attgctagga ttatggtgat taagcggatt gaaagagcaa aaaatgggaa ctttggcgat       120
     cataagctat tggcaaatac cggcggaatt tatgaaatgc ggatagatac cggcaagggg       180
     tatagaattt attacgcaaa aattgaggat attatctatt tgctaacaaa cggtggagat       240
     aaaaaaactc agcaacagga tataagcgat gcccaagtga tattagaaaa atttaaacaa       300
     ttaggagatg atgaaaatga gtga                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page