(data stored in ACNUC7421 zone)

EMBL: CP000947.PE246

CP000947.PE246       Location/Qualifiers
FT   CDS_pept        263689..263988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0250"
FT                   /product="putative transcriptional regulator"
FT                   /note="TIGRFAM: Addiction module antidote protein HI1420;
FT                   KEGG: pfo:Pfl_2007 predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31877"
FT                   /db_xref="GOA:B0UW55"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR014057"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW55"
FT                   /protein_id="ACA31877.1"
FT                   /translation="MSEQNNIEVTDFDAAEFLENDELIALYLAETLKNGNDEEFIQALN
FT                   TVARAKGMNDIAKKAGIARESLYQTLSSNKPRFETVRKILNALNIDLIPTVKTA"
     atgagtgaac aaaacaatat agaagtgact gattttgatg ctgcagaatt tttagaaaac        60
     gatgaattga tcgctttata tcttgcggag acattaaaga atggtaatga tgaagaattt       120
     attcaagcac tcaatactgt ggctagagca aaaggcatga atgatattgc gaaaaaagcg       180
     gggattgctc gtgaaagcct ttatcaaact ctttcaagca ataagccgag atttgaaact       240
     gtgcgtaaaa tcttaaatgc tttaaatatt gatctcattc ctacggtaaa aacggcttaa       300
//

If you have problems or comments...

PBIL Back to PBIL home page