(data stored in ACNUC7421 zone)

EMBL: CP000947.PE248

CP000947.PE248       Location/Qualifiers
FT   CDS_pept        265555..266385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0252"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   dTDP-4-dehydrorhamnose reductase; KEGG: hso:HS_1363
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31879"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW57"
FT                   /protein_id="ACA31879.1"
FT                   /translation="MRAVSIVGLGWLGLTLARHLKNLGWKVKGTKRTHEGVEQMRLIRL
FT                   EAYHLELTPDINADPDDLTALLSVDALVINIPPSQYFFHLQHYVQGVKNLVNEALLNGL
FT                   QHIIFISSTSVFPDVSGEFDEQSQIVPQSEMSKALLEIEQWLFELKDVDCDIIRFGGLV
FT                   GEDRHPVYSLAGKDELSAGNMPINLVHVDDCARAIQLLLETPSSQRLYHLVAPQHPTRA
FT                   EYYSQIAEKLALEAPHFICSEQDPRRVILANKICRELSFVYQCPDPYLMLFERK"
     atgagagctg tttcaatcgt agggttaggg tggttaggtt taacacttgc ccgtcattta        60
     aaaaatttgg gttggaaagt taaaggcacc aaacgcacac atgaaggcgt ggagcaaatg       120
     cgtttaattc gattggaagc ctatcatctg gaactcacac ccgatattaa tgctgatccc       180
     gatgatctaa ctgcattact ttctgtggat gctttagtta tcaatattcc accgagtcaa       240
     tatttttttc atttacaaca ctacgtacag ggcgttaaaa acttagtgaa tgaggcattg       300
     ttaaacggtc ttcaacatat tatttttatc agctcaacct ctgtatttcc tgatgtttca       360
     ggcgaatttg atgaacaaag tcagattgta ccccagtcag aaatgagtaa agcattgctt       420
     gaaattgagc aatggctgtt tgagctgaaa gatgttgact gcgatattat tcgttttggg       480
     ggactggtgg gcgaggatcg tcatcccgtt tattctttag cgggaaaaga cgaattatca       540
     gcagggaata tgccgatcaa tttggtgcat gttgatgatt gtgcaagagc tattcaattg       600
     ttattggaaa caccaagttc ccagcgttta tatcatttgg tcgcaccgca acatccgact       660
     cgagcagaat attactcaca gatagcagaa aaattagcac tggaagcacc gcactttatt       720
     tgttcggaac aagatccaag acgtgttatt ttagcgaata aaatttgccg agagctcagt       780
     tttgtttatc agtgtccaga tccttatttg atgttatttg aaagaaaata a                831
//

If you have problems or comments...

PBIL Back to PBIL home page