(data stored in ACNUC7421 zone)

EMBL: CP000947.PE250

CP000947.PE250       Location/Qualifiers
FT   CDS_pept        267923..268810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0254"
FT                   /product="protein of unknown function DUF535"
FT                   /note="PFAM: protein of unknown function DUF535; KEGG:
FT                   hso:HS_1361 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31881"
FT                   /db_xref="InterPro:IPR007488"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW59"
FT                   /protein_id="ACA31881.1"
FT                   /translation="MKNLFSFPSFYQFSNERRFLKRLRTRIRYYFYRLTCFKECQIFVT
FT                   YLNHNPLWIDIFTKSYYRCDAVLRKYCDNRFNKKQRVQAIMDNFSVAEQVFGRSFSQLL
FT                   VEKDKVLLAELTDELDLYLAINQIDPFEGFFAVNIRNKQGQRIYDASFSFLAGNKLLIT
FT                   SVQGPSDDNSQELIKSTTKQLHGVRPMFMLVNVYKLLAKELNCELLGIAHKNQGKYRWN
FT                   DNARLLFNYDDFWQENNALLNPQGYWQLPVVIERKTLEDIQSKKRSMYRKRYEMFDFIE
FT                   KNITEIFGKENLNK"
     atgaaaaatt tattttcttt tccttctttc tatcagtttt ctaatgaaag acgtttttta        60
     aaacggttaa gaactcgtat tcgctattat ttttatcgtt taacttgttt taaagaatgt       120
     cagatttttg ttacctattt aaatcataat cctctttgga ttgatatatt cacgaaaagt       180
     tactaccgtt gtgatgctgt acttagaaag tattgcgata accgttttaa taaaaaacaa       240
     cgtgtacaag caattatgga taatttttcc gtagcagaac aagtatttgg gcggtctttc       300
     tcacaactgt tagttgaaaa agataaggtt ttattggctg aattaacaga tgagttggat       360
     ttgtatttag caattaatca aatagatcct tttgaggggt tttttgcggt aaatattcgc       420
     aataaacagg gtcaacgtat ttacgatgcc tctttttctt ttttggcagg gaataaatta       480
     ttgatcacgt ctgtgcaagg gcctagtgat gataattcac aagaattaat taaatcgaca       540
     acgaagcaat tacatggtgt acgcccaatg tttatgttgg taaatgtgta taaattgtta       600
     gcaaaagagc tgaattgtga acttttaggc atagcacata aaaatcaagg aaaatatcgt       660
     tggaacgaca atgcacgttt gttatttaat tatgatgatt tttggcaaga aaataatgca       720
     cttttaaacc ctcagggcta ttggcaatta cctgtagtta ttgaacgtaa gacgctggaa       780
     gatattcaaa gtaaaaagcg ttccatgtat cgcaagcgtt atgaaatgtt tgattttatt       840
     gaaaaaaata taactgagat ttttggaaaa gaaaatttga ataaatag                    888
//

If you have problems or comments...

PBIL Back to PBIL home page