(data stored in ACNUC7421 zone)

EMBL: CP000947.PE251

CP000947.PE251       Location/Qualifiers
FT   CDS_pept        268893..269348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0255"
FT                   /product="beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabZ"
FT                   /note="TIGRFAM: beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabZ; PFAM:
FT                   Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase
FT                   FabA/FabZ; KEGG: hso:HS_1360 3-hydroxymyristoyl-(acyl
FT                   carrier protein) dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31882"
FT                   /db_xref="GOA:B0UW60"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UW60"
FT                   /protein_id="ACA31882.1"
FT                   /translation="MTVTTERIARIIESKEIMTLLPHRYPFLLVDRVTDYEEGKWLTAI
FT                   KNVSVNEPCFTGHFPDQPILPGVLILEALAQAMGILAFKTHELSNKELFYFAGVDEARF
FT                   KRPILPGDQMMLKVEVIRERRGITAFTGVASVNGEVACEAKLMCARR"
     atgactgtga caactgaacg tattgcaaga ataattgaat caaaagaaat tatgacactt        60
     ctccctcatc gctatccgtt tttattggta gatcgtgtaa ctgattatga agaagggaaa       120
     tggttaaccg caattaaaaa tgtgagtgta aatgaacctt gttttacagg tcatttccct       180
     gaccaaccta ttttgccggg ggtattaatt ttagaagcat tagcacaagc gatggggatt       240
     ttggcgttca aaactcacga gttaagtaat aaagagctat tttattttgc tggtgtggat       300
     gaggcacgtt ttaaacgtcc tattttaccg ggagatcaaa tgatgttaaa agttgaagtc       360
     attagggaac gccgtggtat taccgctttt actggtgtgg cgagtgtaaa tggtgaagta       420
     gcttgtgaag ccaaattaat gtgtgctcgt agataa                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page