(data stored in ACNUC7421 zone)

EMBL: CP000947.PE252

CP000947.PE252       Location/Qualifiers
FT   CDS_pept        269362..270150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0256"
FT                   /product="acyl-(acyl-carrier-protein)--UDP-N-acetylglucosamine
FT                   O-acyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /note="TIGRFAM:
FT                   acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine
FT                   O-acyltransferase; KEGG: hso:HS_1359
FT                   UDP-N-acetylglucosamine acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31883"
FT                   /db_xref="GOA:B0UW61"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UW61"
FT                   /protein_id="ACA31883.1"
FT                   /translation="MIHSTAKIHPSSIIEEGAKIGENVVIGPFCIVGSDVQIGKGTTLH
FT                   SHVVVKGVTTIGEDNQIFQFASIGEVNQDLKYQGEPTKTIIGHRNRIRESVTIHRGTVQ
FT                   GGGVTRIGDDNLLMINAHIAHDCQIGNRCILANNATLAGHVELGDFVIVGGMSAIHQFV
FT                   IVGAHVMLGGGSMVSQDVPPYVMAQGNHARPFGVNIEGLKRRGFDKPTLHAIRNVYKLI
FT                   YRSGKTLEEVIPEIENYAQTESAVSFFLDFFTRSTRGIIR"
     atgattcatt cgactgcaaa aatccatcct tcttctatta tcgaagaagg tgcaaaaatt        60
     ggtgaaaatg ttgttattgg tcctttttgt attgtgggaa gcgatgtaca aattggtaaa       120
     ggtaccacgt tacattccca tgttgtcgtg aagggagtaa ctaccatagg ggaagataac       180
     caaattttcc aatttgccag cattggtgaa gtcaatcaag atcttaaata tcaaggtgaa       240
     ccaacgaaaa cgattattgg tcatcgtaat cgtattcgtg aaagtgtgac tattcatcgt       300
     gggacagtgc aaggtggtgg tgtaactcgt attggtgatg acaacttgtt gatgattaat       360
     gctcatattg cacatgattg tcaaattgga aatcgttgta ttttagccaa taatgcgacg       420
     ttagcaggac atgttgaatt aggtgatttt gttattgttg gcggtatgtc agccattcat       480
     caatttgtta ttgttggtgc acatgtaatg ctaggtggtg gttctatggt aagtcaagat       540
     gtgccgcctt atgtgatggc acaaggcaat catgcacggc ctttcggagt aaatatagag       600
     gggctaaaac gccgtggttt tgataagccg acactacatg caattcgtaa tgtgtataaa       660
     ctgatttatc gcagtggcaa aacccttgag gaagtcattc ctgaaattga aaattatgca       720
     caaactgaaa gtgcggtgag ttttttcctt gactttttca ctcgatcaac acgtggcatc       780
     attcgttaa                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page