(data stored in ACNUC7421 zone)

EMBL: CP000947.PE255

CP000947.PE255       Location/Qualifiers
FT   CDS_pept        272098..272682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0259"
FT                   /product="molybdenum cofactor synthesis domain"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain; PFAM:
FT                   molybdopterin binding domain; KEGG: hso:HS_1356
FT                   molybdopterin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31886"
FT                   /db_xref="GOA:B0UW64"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW64"
FT                   /protein_id="ACA31886.1"
FT                   /translation="MATLLKIGLVSVSDRASQGVYQDQGIPELLEWLKSALCDPFEVES
FT                   RLIPDEQTLIEKTLCELVDDCHCHLVLTTGGTGPVKRDVTPDATLAVADREMPGFGEQM
FT                   RQVSLHFVPTAILSRQVGVIRRNSLILNLPGQPKAIKETLEGVKDEHGNVIVKGIFSAV
FT                   PYCLQLIDGIYIDTDPNVIESFRPKSARRTL"
     atggctacgc ttttaaaaat tggcttagtt tcagtctctg atcgagcatc acaaggtgtc        60
     tatcaagatc aaggtattcc tgaactgctt gaatggttaa aatctgcttt atgcgatcca       120
     ttcgaagtgg aaagtcgcct aatccccgat gaacaaacct taattgaaaa aacactttgt       180
     gaattagtgg atgattgcca ttgtcatttg gttttaacta caggcggtac tggtcctgta       240
     aaacgagatg taacacctga tgcaactttg gctgttgccg atcgtgaaat gccaggattc       300
     ggtgaacaaa tgcgtcaagt gagtttgcat tttgtgccta ctgcgatttt atctcgtcaa       360
     gttggtgtta ttcgtagaaa tagccttatt ttaaatttac ccgggcaacc caaagcaatt       420
     aaagaaacgc tcgaaggtgt taaagatgaa catggtaacg tcattgtgaa ggggattttc       480
     agtgcagtac cttattgttt gcaactgatt gatgggattt atattgatac agatcccaat       540
     gtaattgaaa gttttagacc gaagtcggca agacgtactt tatag                       585
//

If you have problems or comments...

PBIL Back to PBIL home page