(data stored in ACNUC7421 zone)

EMBL: CP000947.PE256

CP000947.PE256       Location/Qualifiers
FT   CDS_pept        272725..273063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0260"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   hso:HS_1355 nitrogen regulatory protein p-II"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31888"
FT                   /db_xref="GOA:B0UW65"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW65"
FT                   /protein_id="ACA31888.1"
FT                   /translation="MKKIEAIIKPFKLDDVRESLADIGITGMTVTEVRGFGRQKGHTEL
FT                   YRGAEYMVDFLPKVKMEIIVPDEIVEQCIEAIIETAQTGKIGDGKIFVYDVNRVIRIRT
FT                   REENEEAL"
     atgaaaaaaa ttgaagcaat tattaaacct tttaaattag atgatgtacg tgaaagttta        60
     gctgatatcg gtattaccgg aatgacggta acggaagtgc gtggttttgg tcgtcagaag       120
     ggacatacag agttataccg tggtgccgaa tacatggtag actttttacc aaaagtcaaa       180
     atggagatta ttgtgcctga tgaaattgtc gaacaatgta ttgaggcaat cattgaaacc       240
     gcacaaaccg gtaaaattgg tgacggcaaa atttttgtgt atgatgtaaa tcgtgtcatt       300
     cgtattcgta cgagagagga aaatgaggaa gcactttga                              339
//

If you have problems or comments...

PBIL Back to PBIL home page