(data stored in ACNUC7421 zone)

EMBL: CP000947.PE257

CP000947.PE257       Location/Qualifiers
FT   CDS_pept        273063..274115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0261"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   hso:HS_1354 possible permease"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31889"
FT                   /db_xref="GOA:B0UW66"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW66"
FT                   /protein_id="ACA31889.1"
FT                   /translation="MSERNSSLTQVLVACAAIIVILGGIKLASEIVVPFLLSLFIAIIC
FT                   SPVVNFMTKRKIPHWLAITLLFVLIVVLFYFLASLISNTVQEFTQSIPQYKVLLSQRLN
FT                   DLLAFAHHFNIPLFFSTDSINDDFDPSIIMKFVSRFLLSFSNVVTNIFVLFLIVVFMLA
FT                   EAPTVKQKFTKLIVTENTVTQQNYIERILQGVIGYLGVKTITSVMTGLCIYFVLSVLDI
FT                   QYAILWATLVFLLNYIPNIGSIIAAVPVIVQSFLLNGFITGLVVSIAFILINTVVGNVL
FT                   EPKMMGRKLGLSTLIVFLSLLFWGWLLGTVGMLLSVPLTMGLKIALEANPNTIKYAELL
FT                   GDVSDVQNVK"
     atgtctgaaa gaaattcatc gctaactcaa gtgctggttg cttgtgctgc aattatcgtt        60
     attttaggtg gcattaaact cgccagtgag attgttgtgc catttctatt atcgttattt       120
     attgcgatta tttgctcacc tgtggtgaat tttatgacta aacggaaaat acctcattgg       180
     cttgcgatta ctttgctttt tgtattaatt gtggtgttat tttatttttt agccagttta       240
     attagtaata ctgttcagga gtttactcaa tctattcctc aatacaaggt actgttgtca       300
     caacgtttaa atgatttgtt agcttttgct catcatttta atattccttt atttttttct       360
     accgatagta ttaatgatga ttttgatcct agcattatca tgaaatttgt cagtcgtttt       420
     ttgttgagct tctcgaatgt ggtaacaaat atttttgtgt tgtttttgat agttgtcttt       480
     atgcttgctg aagcacctac tgtaaagcaa aaatttacta aattaatcgt tactgaaaat       540
     actgttactc aacaaaatta tattgaacgt attctacaag gcgttatcgg ctatttaggc       600
     gtaaaaacga ttactagtgt gatgacagga ttgtgcattt actttgtttt atccgtcctt       660
     gatattcaat atgctatttt atgggctacc ttggtcttct tattgaatta tattcctaat       720
     ataggatcta tcattgcggc agtccctgtt attgtgcaaa gttttttatt aaatggattt       780
     atcacgggtt tagttgtcag tattgcattt attttgatta atactgtggt tggtaacgtt       840
     ttagaaccta agatgatggg cagaaaattg ggactatcga ctttaattgt ttttctatca       900
     cttttatttt ggggttggtt attaggaaca gtgggaatgt tactttccgt tcctctgaca       960
     atgggattaa aaattgcatt agaggcaaat ccaaatacaa tcaaatatgc tgagttatta      1020
     ggtgatgtaa gcgatgtgca aaatgttaaa tga                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page