(data stored in ACNUC7421 zone)

EMBL: CP000947.PE258

CP000947.PE258       Location/Qualifiers
FT   CDS_pept        complement(274430..275383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0262"
FT                   /product="modification methylase, HemK family"
FT                   /EC_number="2.1.1.72"
FT                   /note="TIGRFAM: modification methylase, HemK family; PFAM:
FT                   putative RNA methylase; methyltransferase small; KEGG:
FT                   hso:HS_1353 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31890"
FT                   /db_xref="GOA:B0UW67"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR017127"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW67"
FT                   /protein_id="ACA31890.1"
FT                   /translation="MSTINQFNQELVDCILTDQVQNSLHTIQDFLRWTYSIFNRSDIYY
FT                   GHGYDNAWDESLQLILTGLHLPLDFPEKLYNSALTTSEKNSLIQLVIARIEQRLPIAYL
FT                   TNSAWFCGLEFYVDERVIIPRSPISALITNKFKGLLQQDPIRILDLCTGSGCIAIACAE
FT                   QFTHAEVDAVDLSIDALNVAEINIERHNLTHRVFPIQSDLFKNLPLDQYDLIITNPPYV
FT                   DEEDLQDMPIEFHHEPEMALGSGIDGLTITKEILANSADYLTDNGILICEVGNSMVHLI
FT                   EQFPEVPFQWLELRNGGIGVFALHKKDLVKYKKKFL"
     atgagtacca taaatcagtt taaccaagaa cttgtagatt gcattttaac agatcaggtt        60
     cagaacagcc tacatacaat acaagatttt ctcagatgga cctatagcat ttttaaccgt       120
     tcagatattt attatgggca tggttatgat aatgcttggg atgaaagtct tcagctcatt       180
     ttaaccggat tacacctccc cctagatttt cccgaaaaac tttataattc agcactcacg       240
     acttcagaga aaaattcact cattcaatta gttattgcta gaattgagca acgtttacct       300
     atcgcctatt taactaatag tgcatggttc tgtggattag aattttatgt agatgaacgt       360
     gttattattc ctcgttcacc aatcagtgct ttaatcacga ataaattcaa agggttactc       420
     caacaagacc caatcagaat tttagatctt tgtactggaa gtggctgtat tgctattgct       480
     tgtgcagaac aatttaccca tgcagaagtt gatgcggttg atttatctat tgacgcatta       540
     aatgttgctg aaatcaatat cgagcgtcat aacctcaccc atcgtgtatt ccctattcag       600
     tcagatttat tcaaaaattt accgctcgat caatatgatt tgattatcac aaacccacct       660
     tatgtggatg aagaagattt gcaggatatg cctatagaat ttcatcatga gccggaaatg       720
     gctttaggct ccggaattga cggcctgact attactaaag aaattttggc aaattctgct       780
     gactatctta ctgataatgg aatactaatt tgtgaagttg gcaatagtat ggttcattta       840
     atagaacaat tcccagaggt gcctttccaa tggttagaat taagaaatgg cggaataggc       900
     gtatttgcac tacataaaaa agacttagta aagtacaaaa agaagttttt ataa             954
//

If you have problems or comments...

PBIL Back to PBIL home page