(data stored in ACNUC7421 zone)

EMBL: CP000947.PE259

CP000947.PE259       Location/Qualifiers
FT   CDS_pept        275468..275974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0263"
FT                   /product="Smr protein/MutS2"
FT                   /note="PFAM: Smr protein/MutS2; KEGG: hso:HS_1352
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31891"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR022990"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW68"
FT                   /protein_id="ACA31891.1"
FT                   /translation="MLNDEDIELFHREIQGAKKIEQNIFIAPRHRNLKNKVEIRNVREK
FT                   EDTLFFFSDEYEPLLNEDGTVKYLRPHEDRYLLKQLRRGDFSPELFLDLHGLTRKEAKI
FT                   ELASLIHACEKEHVYCACIMTGYGTYTLKQQIPRWLVQHPRVRALHQAPREWGGDAAIL
FT                   VLLDV"
     atgttaaatg atgaagatat agaactattt catcgtgaaa ttcaaggagc aaaaaagata        60
     gaacagaata tttttattgc accacgtcat cgaaatttaa aaaataaagt ggagattcgc       120
     aatgttcgag aaaaagaaga taccttattt ttcttttcag atgaatatga acctttatta       180
     aatgaagatg gcacggttaa atatttacgt ccacatgaag atcgttattt gttaaagcaa       240
     ttacgccgtg gtgatttctc gcctgaactt tttttggatt tacatggttt gacacgtaaa       300
     gaggcaaaaa ttgagctggc aagccttatt catgcctgtg aaaaggaaca tgtttattgt       360
     gcttgcatta tgacgggata tggaacttat acattaaaac aacaaatacc tcgttggcta       420
     gtgcaacatc caagagtaag agcgttacat caggcaccca gagaatgggg aggcgacgct       480
     gcaattttgg tattgttgga cgtttag                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page