(data stored in ACNUC7421 zone)

EMBL: CP000947.PE26

CP000947.PE26        Location/Qualifiers
FT   CDS_pept        21934..22356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0026"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: hso:HS_0160
FT                   thiosulfate sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31887"
FT                   /db_xref="GOA:B0UUY4"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR023695"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUY4"
FT                   /protein_id="ACA31887.1"
FT                   /translation="MYFTVKSFLEKVSLPYKETVLYCEILLLLNYHKMTTFKEINSEQA
FT                   WEILNNKNAVLVDIRDLSHFIYSRPKSAFHLTHQRFSEFQQKYEYDQPIIVSCYHGVSS
FT                   RNVAQFLVEQGYDEVYSLIGGFAGWVQANLPVESGY"
     gtgtatttta ctgtaaaatc ctttttggaa aaagtgagtt taccctataa agaaacagtg        60
     ttatattgcg aaatactttt attgttaaac tatcataaaa tgactacatt caaagaaatc       120
     aactctgaac aagcatggga aatattaaat aataagaatg ctgtattagt agacattcgt       180
     gatttatccc attttattta cagtcgtccg aaaagtgctt ttcatttaac tcatcagcgt       240
     tttagtgaat tccaacagaa atatgaatac gaccaaccga ttattgtgag ttgttatcat       300
     ggtgtgagca gccgcaatgt ggcacaattt ttagttgagc aaggctatga tgaagtttat       360
     agcttaattg gaggtttcgc cggttgggta caagcgaatt taccggtgga aagtggatat       420
     taa                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page