(data stored in ACNUC7421 zone)

EMBL: CP000947.PE261

CP000947.PE261       Location/Qualifiers
FT   CDS_pept        complement(278166..278624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0265"
FT                   /product="methylglyoxal synthase"
FT                   /EC_number="4.2.3.3"
FT                   /note="TIGRFAM: methylglyoxal synthase; PFAM: MGS domain
FT                   protein; KEGG: hso:HS_1350 methylglyoxal synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31893"
FT                   /db_xref="GOA:B0UW70"
FT                   /db_xref="InterPro:IPR004363"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR018148"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UW70"
FT                   /protein_id="ACA31893.1"
FT                   /translation="MQTTYRKLAKNKKIALVAHDHCKQDLIQWCQTNRTLLQPHILYAT
FT                   GTTGNLIHQETNLEIKNLLSGPMGGDQQLGGLIAEGKIDLLIFFWDPMNAVPHDPDVKA
FT                   LMRIATVWNIPVAMNIATADFLISSPAFQQETEIRIPDYQGYLKERLK"
     atgcaaacaa cctatcgcaa attggcaaaa aacaaaaaaa ttgctttggt tgcacacgat        60
     cactgcaaac aagatttgat acaatggtgt caaactaacc gcactttact tcaacctcat       120
     attctttatg caacggggac aactggaaat ttaattcatc aagaaacgaa tttagaaatc       180
     aaaaatttac ttagcggtcc tatgggagga gatcaacagt tgggtggctt aattgcagaa       240
     gggaaaattg acttgctgat attcttttgg gatccaatga atgcagttcc tcatgatcct       300
     gatgtcaaag ccttaatgcg tattgcaact gtttggaaca ttcctgttgc gatgaatatt       360
     gctactgctg attttttaat tagttctcct gcattccaac aagaaactga aattcgtatt       420
     ccggactatc aaggttactt aaaagagcgg ttaaaataa                              459
//

If you have problems or comments...

PBIL Back to PBIL home page