(data stored in ACNUC7421 zone)

EMBL: CP000947.PE262

CP000947.PE262       Location/Qualifiers
FT   CDS_pept        complement(278689..279342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0266"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_1349 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31894"
FT                   /db_xref="InterPro:IPR018635"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UW71"
FT                   /protein_id="ACA31894.1"
FT                   /translation="MKFSFAALASAMLLTSTAAFAGIVTSSSNIDFLAIDGQKANKDLL
FT                   KSTKSFNINESQTHQVVVRVSEIVRHGSDRSLYESDPIVVTFQGTNEDVVISAPKLENE
FT                   RDIKNFKDSPSVIVKTNSGKIIATKQEILKQEGFLPGANLIDTLSEYNASGSVASVSNF
FT                   ATAMPAVALGFAKAQKGKVVVQGENIAEQQLQFWFQQADKETQARFINWAKNQK"
     atgaaatttt cttttgcagc acttgcaagt gcaatgctat taacaagtac agcagctttt        60
     gccggtatag taaccagttc atcaaacata gatttcttag ctattgatgg acaaaaagct       120
     aataaagatc tattaaaatc tactaaatca tttaatatca atgaatcgca aactcaccaa       180
     gtcgtcgttc gtgtttcaga aattgttcgt catggctcag atcgttcttt atatgaatca       240
     gatcctattg ttgttacatt tcaaggcaca aacgaagacg tagttatctc agcccctaaa       300
     ctggaaaatg aacgagatat taaaaatttt aaagattcac cgtctgtcat cgtcaaaaca       360
     aatagcggaa aaataattgc gacaaaacaa gaaatactga agcaagaagg tttccttcca       420
     ggggctaacc taattgatac attatctgaa tataatgcat ccggttctgt tgcttcagtt       480
     tccaactttg caacggcaat gcctgctgtt gctctcggat ttgctaaagc acaaaaagga       540
     aaagttgttg tacaaggtga aaatattgcg gagcaacaat tacagttttg gttccaacaa       600
     gcagataaag aaactcaagc tcgtttcatc aattgggcga aaaatcaaaa atag             654
//

If you have problems or comments...

PBIL Back to PBIL home page