(data stored in ACNUC7421 zone)

EMBL: CP000947.PE263

CP000947.PE263       Location/Qualifiers
FT   CDS_pept        279733..281478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0267"
FT                   /product="Polypeptide-transport-associated domain protein
FT                   ShlB-type"
FT                   /note="PFAM: Hemolysin activator HlyB domain protein;
FT                   Polypeptide-transport-associated domain protein ShlB-type;
FT                   KEGG: msu:MS1169 FhaC protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31895"
FT                   /db_xref="GOA:B0UW72"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="InterPro:IPR027282"
FT                   /db_xref="InterPro:IPR035251"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW72"
FT                   /protein_id="ACA31895.1"
FT                   /translation="MKKMSVLIWLCGFSSLLSAVERPLLQLNRIDAQQQQRQKEQIQQQ
FT                   SERLRSDPDVRMEISSEKPTALPFNESPCYPIQHLSIVDYSSDNKTKPSQFQWALNKAV
FT                   TQLNLQLPHCFGTQGLGILMKQVQNNVIERGYITTRVVAGEQNLTQGVFSLTVIPGQVR
FT                   HTIIADVSSLPWFSKLTAKTALAFKQGDLVNIRDIEQSLENLKRVPTADANIDILPADN
FT                   SSAFGESDIKITYQQRFPFRFSLNLDDSGSTSTGKWQGSATLSWDNLFSANDLFYTTFT
FT                   HSLKRHSDNSGRRATRNYGFYYSVPLGYWALSASLYKTDYHQDVFGAFDNTYLYAGRSE
FT                   TTNLNLAYRLYRDAVRKTTISGGFWSRHSKNYIDDAEIDVQRRRMAGWQLNLSHIEYIK
FT                   AVTLKLSLGFKWGTGVGRTIAAPEEYWGNGTSRPKIITASVDINYPFYMGKQPLAFNTT
FT                   WSTQWNKTPLIQQDRLSIGGRYTVRGFDGELTLSGERGWLWRNELSWNIANKGHWVYLA
FT                   LDGGRVMGRSDGIRLGHHLMGTVLGLRGSWTHFYYDVFIGRPLSKPSGFRTSHTVTGFN
FT                   IGLTF"
     atgaaaaaaa tgtcggtatt aatttggctt tgcggttttt catcattatt gtcggcggta        60
     gaacgaccgc tcctccaatt aaatcgtatt gatgcccaac agcaacaacg ccaaaaggaa       120
     caaattcaac agcaaagtga acgacttcgt tccgatcccg atgtgagaat ggaaatttct       180
     tcagaaaaac ctaccgcact tccctttaat gaatctcctt gctatcccat tcaacatctt       240
     tccattgtag attactcctc cgataacaag acaaaaccta gccaatttca atgggcactg       300
     aataaagctg ttacgcaatt aaacctccaa ttaccgcatt gtttcggaac tcaaggacta       360
     gggattttga tgaaacaggt gcaaaataat gtgattgaac gaggctatat cacaaccaga       420
     gtggttgccg gcgaacaaaa tttaacgcaa ggcgtatttt ctttaacggt tattcccggt       480
     caagttcgcc atacgattat tgccgatgta agtagtctcc cttggtttag taaactgaca       540
     gctaaaaccg cattggcatt taaacaggga gatttagtta atatccgtga tattgaacaa       600
     tccttggaaa atctcaaacg tgtgccaact gcagatgcca atatcgacat tcttccggct       660
     gataacagtt cagcattcgg tgaaagcgat attaaaatca cctatcagca gcggtttcca       720
     ttccgattta gcttaaattt agatgattcg ggttcaacat ctacggggaa atggcaaggc       780
     tctgccaccc tttcgtggga taatcttttt tctgccaatg atttattcta taccactttc       840
     acacatagct taaaacgtca cagcgataat tcggggcgtc gagcaacgag aaactatggc       900
     ttctattatt ctgttccttt gggttattgg gcactctccg cctcattgta taaaacagat       960
     tatcatcaag atgtctttgg ggcgtttgat aatacttacc tctatgcagg gcgtagtgag      1020
     acaaccaatt tgaatcttgc ctatcgtctt tatcgagatg cggtacgtaa aaccacaatt      1080
     tcaggtggct tttggtctcg ccactcgaaa aactacattg atgatgctga aattgatgtt      1140
     caacgtcgcc gaatggctgg ttggcaactc aaccttagcc atattgaata tattaaggca      1200
     gtaacactga agctttctct aggatttaaa tggggaacag gtgtaggtcg caccatagcg      1260
     gcaccggaag aatattgggg aaacggtact tctcgtccta aaattattac cgcctcggta      1320
     gacattaatt atcctttcta tatggggaag caacccttgg catttaatac gacttggtcc      1380
     actcaatgga ataaaactcc tcttattcaa caagatagat tgagcattgg tgggcgttat      1440
     acggtgcgtg gatttgacgg tgagcttacc ttatcgggcg agcgaggttg gctatggcgt      1500
     aatgaactca gttggaatat tgcaaataaa ggacattggg tttacttagc cttagatggc      1560
     ggtagagtga tgggacgtag tgatggaata cgattagggc atcatttaat ggggacagtt      1620
     ttaggtctgc gtggtagttg gacgcatttt tattatgatg tatttattgg acggccatta      1680
     agcaagccga gcggttttag aacatcgcat accgtaaccg gctttaatat cggcttaacc      1740
     ttttaa                                                                 1746
//

If you have problems or comments...

PBIL Back to PBIL home page