(data stored in ACNUC7421 zone)

EMBL: CP000947.PE264

CP000947.PE264       Location/Qualifiers
FT   CDS_pept        281512..288630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0268"
FT                   /product="filamentous haemagglutinin family outer membrane
FT                   protein"
FT                   /note="TIGRFAM: filamentous haemagglutinin family outer
FT                   membrane protein; adhesin HecA family; PFAM: Haemagluttinin
FT                   repeat-containing protein; filamentous haemagglutinin
FT                   domain protein; KEGG: nme:NMB1768
FT                   hemagglutinin/hemolysin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31896"
FT                   /db_xref="GOA:B0UW73"
FT                   /db_xref="InterPro:IPR008619"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR025157"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW73"
FT                   /protein_id="ACA31896.1"
FT                   /translation="MNKRQFRVIFSKTLQPIVVVSEPVKTEGKTKSEMPQMQSAVNFLP
FT                   IFAALTPLVFRLFCALSFVFSSSVFAETLIIKADPNAPKNQQPIVLQTANGLPQVNIQT
FT                   PNDKGLSHNKYQDFNVDKKGAILNNSHKDTQTQQAGWVQSNPYLARGEAKVILNEVTST
FT                   HPTQLKGYVEVAGRKAEVIIANPNGLHCDGCGTINATRSTMTTGKPQIIDGQVESINIE
FT                   RGKITISGKGLDNSRVNYTDILAREAEINAGVWAGKKLNVVTGKNTIKQADMEHGGNDL
FT                   QITHIDSQNLSENAPHFALDVSELGGMYAGKIHLVGTEQGLGVRNAGHIGASADNLVID
FT                   SQGKIVNQGMISAKGNLHVSTKKEIQNQGQLLTEAQLSTKSSHLDNRGGKIEGRTAQIN
FT                   ATETVNNDRIGSTGSLIQTAEKLDIHSKLVTNKNTKASQSKPPEQGIIAGVLTINGDAL
FT                   ANQNGAIYGMQNVQLNLSVHLDNQQGEILSLGELQIQGDKLNMNNEHGEIASRSNLAIY
FT                   ANKLESEGEIESSHNASIHLKQDLTLNNAFKVGGNLDFQTQGNFINNSVLRVGEKLSIQ
FT                   AHNINNNRESELSGKNTQILSNEIINRGLIDGEKTLLKSTALSNLGTGRIYGNHLAIAT
FT                   PNLINGKEDNASPTIAARERLDLAVGSLINRDHALIFSAGEMGIGGHLNEQHHAEGKAS
FT                   FIDNGSATIEALGNAYVNTARLQNHDLHLRLGENHTDERRVEYAPKNTSRRYVLIDKDG
FT                   NHGRFDSRNNSRSDRNSYLRLNDGTTIAANSWMHWDYNRHTITTTIEKRDPAKILIGGD
FT                   LHLSGNDLENNASTLSVGKRLLLGDEVFIKNDKNETLHSTTGTSLNNIDIAGTINVTDK
FT                   GHWDSFHKKKRRYGIRGRKRWAVYGTGRGDLNDIHPTSHFFFNKVDNTIGQPVDSTNTQ
FT                   ITAQAEAIVPNQMNGVIINLPEQSLYQINPDAPNGYLVETDPHFTNRKQWLSSDYMLNA
FT                   LRYNHENVQKRLGDGFYEQRLINEQIHQLTGRRFLDNHQTDDEQYKALMDSGIYYAKKF
FT                   NLHLGVGLTAEQMAELTADMVWFVNKEITLPSGKKLTVLTPQVYLVARNLDVTSQGALI
FT                   SAREIMGNINGKLTNTGTIAGRNLTALSAKNINNQGLVLGDSVNLLAKQKLVNLGGRIE
FT                   ALDSVTLVGKEGVDIASTTTRLAYQDDFGNKFDRTHVDNLAGIHVKDKNGKLIVHSPKD
FT                   VTIKGAELNSAGGILVQANHIDIGTLNTKNKTDYNADMDNYYRLEQHQEVGSQLNGKGN
FT                   ITLAGEQGVVIRQGEIHSENGDVHIASNGNIRIEEGRNKERLSSASKVKHSGFLQSTTD
FT                   ITKHDHHYDLAQGSTLDGKNVVLQSNANLTVQGSNIVAENQLNARAKNIAIKEAENRVF
FT                   EQDVEKTTKSGLMSSGGFGFSIGEKKTTTETNQTKYYATGSQVGSLKGDTALIAGKHYQ
FT                   QTGSTLSSLEGDVTIGAKKVDILAADDRYESRYKQTMEQKGFTIAVNIPVVQAVQNALA
FT                   VAKQAEQVGESKHSRINAMAAANTAWSAYRAGQGLMQASQSLSQMANGNMAQGANVSVS
FT                   ITYGEQKNVQTTDIQGNTAANSAINAGGKVTVTATGAGKESDIHVVGSDVSGQQGTLLQ
FT                   AEDEINVLAAKQTHQERSQNKSAGFNAGVAVSYGSNGLAFGFTVGGNYGKGYGNGDETT
FT                   YRHSHIGDKHSQTHIMSGGDTTLRGAQVRGKGVQVHAQNLSIESLQDTMTYKGKQMNVS
FT                   GQVTVGYGFSASANFNQSKINADYASVQEQSGIYAGDEGYQINIAQHTDLKGGLITSTA
FT                   QAENQGKNQFSTGTLSYSDIQNHADYNGSAVGVGVQADINGGWDGRQVRDGSPVSRVNQ
FT                   GIGFGYDKDSQSSLTKSGINTQNLIIRDEQGQLAKTGKTIETTRGEISTNITTDSAEQH
FT                   TGKLAPNFDKERLQKELDLQREVTQKFDQTRQEVKAELYDIVDEKREKATQIRKINGGY
FT                   DTELSAQLDREATDLDEKVRWLDMGLGLLQGSAGNSKTMLGVFAGTQADRAVRSATAPK
FT                   EMWYHKKVINEKTGKVKLESRQIWSLNDLSREELASIQDTNGKVITVSNPGIFNNREDS
FT                   LSNAEKQNLNSTNSSGVIVVMNPPTGNYKGWWILSSMVSELMYVGYDQLNNKVFQGYLP
FT                   KTNSEKLNQDIYREVQNMGNGWSVDTDNHSRGGITASVALKDWVNNKEQNGIAPIRKAR
FT                   FYGTATNVQNDYADVLQKNGYTYTSADGKTYNSGAYSIVHDKDFVGNKWIPFLLGNNET
FT                   TKGDCGIFCYSHSSYFAEVPEQYQRDEDGNIKMENGKPVETENWKDYTKKWGTPKTGAD
FT                   GDINHAIPKLVNPNNPNGEKYETNPF"
     atgaataaac gtcagtttcg tgtgattttt agcaaaacat tgcaacctat tgtcgtggtt        60
     tcagaaccgg taaaaaccga aggaaaaaca aaaagtgaga tgcctcaaat gcaaagtgcg       120
     gttaattttc tacccatttt tgccgcctta actccccttg tctttcgttt gttctgtgct       180
     ttgagttttg tcttttcctc gtctgtattt gcggaaacct taatcatcaa agccgatccc       240
     aacgctccca aaaatcaaca acctattgtg ttgcaaacag cgaacggatt accgcaagtc       300
     aatattcaaa ccccgaatga taaagggctt tctcataata aataccaaga ttttaatgta       360
     gacaaaaaag gggcgattct taataacagc cacaaagaca cacaaacaca gcaagcaggt       420
     tgggtacaaa gcaatcctta tcttgctcgt ggcgaagcaa aagtgattct caacgaggta       480
     acatctacac atccaaccca acttaaaggt tatgtggaag tggcaggcag aaaagccgaa       540
     gtgatcatcg ctaatccaaa tgggcttcat tgtgatgggt gcggtacgat taatgcgaca       600
     cgctcaacaa tgaccacagg caaaccgcag attattgatg gacaagtaga aagcattaac       660
     atagaaagag gcaaaataac catcagtggc aaagggttag ataacagtcg tgtcaattat       720
     accgatattc ttgctcgaga agcggaaatc aatgcaggcg tttgggcggg gaaaaagctt       780
     aatgtggtaa ccggcaaaaa caccatcaaa caggcagata tggaacatgg cggaaatgat       840
     ttacaaatta cccatattga cagccaaaat ctcagtgaaa acgcaccgca ctttgcttta       900
     gatgtgagtg agcttggcgg tatgtatgcg gggaaaattc atcttgtcgg cacagaacaa       960
     ggactggggg tgcgtaatgc agggcatatt ggggcaagtg cggacaattt agtgattgat      1020
     tcacaaggta aaattgtcaa tcaaggaatg atttctgcga agggaaatct acacgtcagt      1080
     acgaaaaaag aaattcagaa ccaagggcaa ttactcaccg aagctcagct aagtaccaaa      1140
     agttctcatt tggataaccg tggcggtaag attgaaggaa gaaccgcaca aattaatgcg      1200
     accgagacag tgaataatga tcgcataggt tcaacaggat ctttgattca aaccgctgaa      1260
     aaacttgata ttcacagcaa actcgttaca aacaaaaaca cgaaagcgtc acaaagtaag      1320
     ccccctgaac aaggtattat tgcaggtgta ctgacaataa atggcgatgc tcttgccaat      1380
     caaaacgggg caatttatgg catgcaaaat gttcaactta atctttcggt acacttggat      1440
     aatcagcaag gcgaaattct ctctcttggt gagttacaaa ttcaaggcga taaacttaat      1500
     atgaataatg aacatgggga aatcgcaagc agaagtaatt tagctattta tgccaataaa      1560
     ttagaatctg aaggagaaat tgaaagtagc cacaatgcga gtattcacct caagcaagat      1620
     ttaacgctta ataatgcttt caaagtaggc ggtaatttag acttccaaac acagggcaat      1680
     tttatcaaca actcagttct tcgtgtggga gagaaactaa gcatacaggc tcataatatc      1740
     aataataaca gggagagtga gctatccggt aaaaacaccc aaattctcag taatgaaata      1800
     attaatcgag gattaattga tggtgaaaaa accttattaa aaagcaccgc actttctaac      1860
     cttgggacag ggcgaattta tggcaatcat ttagccattg cgacaccaaa tcttatcaat      1920
     ggcaaagaag acaatgcttc gccaaccatc gcagcacgtg aacgattaga tttggcggtc      1980
     ggttcactta tcaatcgtga tcatgcgtta atttttagtg cgggagagat gggcattggc      2040
     ggtcatctta atgaacagca ccatgctgag gggaaagctt cattcattga taatggcagt      2100
     gcgactattg aggctttggg aaatgcttat gtgaatacag cacgcctaca aaatcacgac      2160
     ttacacttgc gattggggga aaatcacacc gatgaacggc gagttgaata tgcaccgaaa      2220
     aatacatctc gacgctatgt actgatagat aaagatggca atcacgggcg atttgattca      2280
     agaaataata gtaggagcga tagaaattct tatttaaggc tgaatgacgg cacaaccatt      2340
     gcggctaata gttggatgca ttgggattat aatcgccaca ctattacgac aacgattgaa      2400
     aaacgtgatc cggctaaaat tttgattggc ggtgatcttc atttatcagg caatgatctt      2460
     gaaaataatg cgtctactct ttctgtagga aaacgcttat tactcggtga tgaggtattt      2520
     ataaaaaatg ataaaaatga aacgttacat tccacaaccg gtacatcgct caataatatt      2580
     gatattgcag gaacgataaa tgttacggac aaaggacatt gggatagctt ccataaaaag      2640
     aaacgtcgct atggaataag gggaaggaaa cgttgggcgg tttatggtac cggaagaggg      2700
     gatttgaatg acattcaccc gacgagccat ttcttcttca ataaggtgga taatactatc      2760
     ggtcagcctg ttgacagcac caacacgcaa attacagctc aagctgaggc gattgtgcca      2820
     aaccaaatga atggcgtaat tattaactta ccggaacaaa gtctatatca gattaacccc      2880
     gacgccccta atggttattt agtggaaacc gatccgcact ttactaaccg taaacaatgg      2940
     cttagctccg actatatgct taacgcattg cgttacaatc acgaaaatgt gcagaaacga      3000
     ttgggagacg ggttttatga acaacgcttg attaatgaac aaattcatca actcaccgga      3060
     cgacgctttt tagataatca ccaaaccgat gatgagcaat acaaagcctt aatggatagc      3120
     ggtatttatt atgccaaaaa atttaacctg cacctcggtg tcggcttaac agcggagcaa      3180
     atggcagagt tgactgcgga tatggtatgg tttgtgaata aagaaattac gctaccgagc      3240
     ggcaaaaaac tgacggtact cactccacaa gtttatcttg ttgcacgaaa tcttgatgta      3300
     acttcacaag gtgctttaat ttcagcaaga gaaattatgg gtaatattaa cggaaaactt      3360
     accaatacgg gaacgattgc ggggcgaaat ctgaccgcac tttctgccaa gaatatcaac      3420
     aaccaagggc ttgttttggg ggattccgtc aatttacttg caaagcaaaa attagttaac      3480
     ctcggcggta gaattgaagc tcttgattca gtgacattag tcggcaaaga aggtgttgac      3540
     attgcaagta caacaactcg cctagcttat caagatgact ttggtaataa atttgaccgc      3600
     actcatgtag ataaccttgc cggtattcat gtcaaagata aaaacggtaa attaattgtt      3660
     cacagcccaa aagatgtaac tattaaaggt gcagaactca atagtgcagg cggaatactt      3720
     gttcaagcca accatattga tattggtacc cttaatacaa aaaataaaac ggattacaat      3780
     gcggatatgg ataattacta ccgcttagaa cagcatcaag aagtcggttc tcaattaaat      3840
     ggaaaaggta atatcaccct tgccggtgaa cagggcgttg tgattcgcca aggggaaatt      3900
     catagcgaga acggtgatgt tcatattgcc tcaaacggta atattcgcat tgaagaaggg      3960
     cgtaacaaag agcggctttc ctctgcctct aaagtgaagc atagtggttt tcttcaatcc      4020
     acgacagata tcactaaaca tgaccaccat tatgatttag ctcaaggctc aacccttgat      4080
     ggtaagaatg tggtgttgca aagcaatgct aacctgacgg ttcaaggctc aaatattgtt      4140
     gctgaaaatc agctcaatgc tcgagcgaaa aacatcgcaa ttaaggaagc agaaaaccgt      4200
     gttttcgaac aagatgttga gaaaaccacg aaatcaggct taatgagttc agggggattt      4260
     ggctttagca ttggcgaaaa gaaaaccacc acagaaacca atcaaaccaa atattacgcc      4320
     acaggtagcc aagtgggaag cctgaaaggt gataccgccc ttattgcagg taaacactac      4380
     caacaaaccg gcagtaccct ctcttccctt gagggcgatg tgactatcgg tgcgaaaaaa      4440
     gtcgatattt tggctgcaga tgaccgatac gaaagccgtt ataaacagac gatggaacaa      4500
     aaaggtttta cgattgcggt gaatattccg gtggtgcagg cggtacaaaa tgcccttgcg      4560
     gtagcgaaac aagccgaaca ggtgggcgaa agcaaacaca gtcgaattaa tgccatggcg      4620
     gcggcgaata cggcgtggag tgcgtatcga gcgggacaag ggttaatgca agcgagtcaa      4680
     agtctcagcc aaatggcgaa cggcaatatg gcacaagggg cgaatgtcag cgtatctatc      4740
     acttatggcg aacaaaagaa tgtgcagacc acggatatcc aaggcaacac tgcagcaaac      4800
     agtgcgataa atgcaggtgg aaaagtcacc gttaccgcca ccggagcggg caaggaatcg      4860
     gatattcacg ttgtggggtc tgatgtatca ggtcaacaag gcaccctctt acaagcagaa      4920
     gatgaaatca atgttcttgc agccaaacaa acgcaccaag agcggagcca aaataaatcc      4980
     gccggcttta atgcgggtgt ggcggtgagt tacggctcaa atggtttagc ctttggattt      5040
     accgtagggg gaaattatgg caaaggctat ggcaacggcg atgaaaccac ctaccgtcat      5100
     agtcatattg gcgataaaca cagccaaacc cacatcatga gcggtgggga tacgaccctt      5160
     cgtggtgcac aagtgcgggg caaaggcgta caggttcatg cccaaaacct cagcattgaa      5220
     agtctgcaag atactatgac ctataaaggc aaacaaatga atgtgagcgg acaggtaacg      5280
     gtgggctatg gcttttccgc ctccgccaac ttcaatcaat cgaaaatcaa cgccgattat      5340
     gcgagcgtac aagaacaatc ggggatatat gcaggagatg aggggtatca aattaacatt      5400
     gcccaacaca ctgacctcaa aggcggctta atcacctcca ccgcccaagc cgaaaaccaa      5460
     ggtaaaaacc aattcagcac aggcacactt tcttattcgg atattcaaaa tcatgctgat      5520
     tataatggga gtgcggttgg tgtaggagta caagcagata ttaacggtgg ctgggacggt      5580
     cgtcaggtta gagatggctc accggtaagt cgagtgaatc aaggtatcgg ctttggttat      5640
     gacaaagaca gccaatccag cctaacaaaa agcggtatta atacgcaaaa cctcatcatt      5700
     cgtgacgaac aaggacagtt ggcgaaaacg ggaaaaacta tagaaacaac aagaggggaa      5760
     atcagcacaa acatcactac ggattccgca gagcaacata caggcaaact ggcaccaaac      5820
     tttgataaag agcggttaca aaaagagttg gatttacagc gagaagttac gcaaaaattt      5880
     gatcaaactc ggcaggaagt taaggctgaa ctgtatgata tcgttgatga aaaacgagaa      5940
     aaggcaacgc aaattcgcaa aatcaatggt ggttatgata ccgaactttc cgctcaatta      6000
     gatcgtgagg caacggattt agatgaaaaa gtgcgttggt tagatatggg attaggtctt      6060
     ttacaaggta gtgcgggaaa tagcaaaaca atgttaggtg tttttgcggg cactcaagcc      6120
     gatcgtgccg ttcgttctgc cacagcacct aaagaaatgt ggtatcacaa gaaagtaatt      6180
     aatgaaaaaa ccggcaaagt gaagttagaa tcaagacaaa tttggtcatt gaatgattta      6240
     agcagagaag aactggcaag cattcaagac acaaatggca aagttattac tgtgtctaat      6300
     cccggtattt tcaataatcg agaagattca ttaagcaacg cagaaaaaca aaatcttaat      6360
     agtacaaaca gcagtggtgt cattgtggtt atgaatcctc caacagggaa ctataaaggc      6420
     tggtggatac tgtcttctat ggtttctgaa ctgatgtatg tcggttacga ccaattgaat      6480
     aataaagtgt tccaaggcta tttacccaaa actaattcag aaaaattgaa tcaagatatt      6540
     tatcgagagg ttcaaaatat gggaaatggc tggtcggttg ataccgacaa tcatagtcgt      6600
     ggtggtatta cagccagtgt tgctttaaag gattgggtaa acaataaaga gcaaaacggc      6660
     attgccccaa tcagaaaagc acgtttctat ggtacagcca caaatgtgca gaatgattat      6720
     gccgatgtgt tacagaaaaa cggttatacc tatacgagtg cggacggaaa aacttataac      6780
     agcggagcct actcaatcgt gcatgataaa gattttgtgg ggaacaaatg gatacctttc      6840
     ttgctaggaa ataatgagac aacaaaagga gattgtggga tattttgtta ttcgcatagc      6900
     tcgtattttg cggaagttcc tgagcagtat caaagagatg aagatgggaa tattaaaatg      6960
     gaaaatggga aacctgttga aacagaaaac tggaaagatt acacaaaaaa atggggaacc      7020
     cctaaaacag gtgctgatgg tgatataaat catgctattc caaaattagt caatcccaat      7080
     aatccgaatg gagaaaaata tgaaacaaat cctttttaa                             7119
//

If you have problems or comments...

PBIL Back to PBIL home page