(data stored in ACNUC7421 zone)

EMBL: CP000947.PE265

CP000947.PE265       Location/Qualifiers
FT   CDS_pept        288599..288940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0269"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nme:NMB1764 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACA31897"
FT                   /db_xref="GOA:B0UW74"
FT                   /db_xref="UniProtKB/TrEMBL:B0UW74"
FT                   /protein_id="ACA31897.1"
FT                   /translation="MEKNMKQILFKYFMLITCVLGLSGCGYLLSLGQLMLDGRCADWNC
FT                   SKPTPRWRKAVDDCYSRNFGVVKQQLGYKDHGEVQDSDIGQHISYQCVRHDGRYDIRKD
FT                   KQYGHLFVK"
     atggagaaaa atatgaaaca aatccttttt aaatatttta tgctaattac ttgtgttttg        60
     ggattaagtg gctgcggtta tttgctatca cttggacagt taatgcttga tggtaggtgt       120
     gcagattgga attgttctaa acctacgcca agatggagaa aggcagttga tgactgttac       180
     agtagaaact ttggagttgt taagcaacaa ttaggataca aagatcatgg agaagttcag       240
     gatagcgata ttgggcagca tatttcttat cagtgtgttc gacatgacgg cagatacgat       300
     attcgcaaag ataagcagta tgggcattta tttgtgaaat ga                          342
//

If you have problems or comments...

PBIL Back to PBIL home page